product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Irisin/FNDC5 Antibody - BSA Free
catalog :
NBP2-14024
quantity :
0.1 ml (also 25 ul)
price :
549 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 6
Reference
Cebulski K, Piotrowska A, Kmiecik A, Haczkiewicz Le x15b niak K, Ciesielska U, Grzegrz xf3 x142 ka J, et al. The Role of Irisin/FNDC5 Expression and Its Serum Level in Breast Cancer. Int J Mol Sci. 2023;24: pubmed publisher
Nowi x144 ska K, Jab x142 o x144 ska K, Ciesielska U, Piotrowska A, Haczkiewicz Le x15b niak K, Pawe x142 czyk K, et al. Association of Irisin/FNDC5 with ERRα and PGC-1α Expression in NSCLC. Int J Mol Sci. 2022;23: pubmed publisher
Cebulski K, Nowi x144 ska K, Jablo x144 ska K, Romanowicz H, Smolarz B, Dzi x119 giel P, et al. Expression of Irisin/FNDC5 in Breast Cancer. Int J Mol Sci. 2022;23: pubmed publisher
Wozniak S, Nowińska K, Chabowski M, Dziegiel P. Significance of Irisin (FNDC5) Expression in Colorectal Cancer. In Vivo. 2022;36:180-188 pubmed publisher
Pinkowska A, Nowińska K, Ciesielska U, Podhorska Okolow M. Irisin Association with Ki-67, MCM3 and MT-I/II in Squamous Cell Carcinomas of the Larynx. Biomolecules. 2021;12: pubmed publisher
Nowińska K, Jablonska K, Pawelczyk K, Piotrowska A, Partynska A, Gomulkiewicz A, et al. Expression of Irisin/FNDC5 in Cancer Cells and Stromal Fibroblasts of Non-small Cell Lung Cancer. Cancers (Basel). 2019;11: pubmed publisher
product information
master code :
NBP2-14024
SKU :
NBP2-14024
product name :
Irisin/FNDC5 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The Irisin/FNDC5 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Irisin/FNDC5. This antibody reacts with human,mouse. The Irisin/FNDC5 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,IF/IHC,Immunohistochemistry-Paraffin,Immunofluorescence,Immunocytochemistry/ Immunofluorescence,Western Blot.
target :
Irisin/FNDC5
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKN
KDEVTMKEMGRNQQLR
This antibody was developed against a recombinant protein corresponding to the amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
FNDC5
applications :
Immunohistochemistry,IF/IHC,Immunohistochemistry-Paraffin,Immunofluorescence,Immunocytochemistry/ Immunofluorescence,Western Blot
USD :
549 USD
alt names :
fibronectin type III domain containing 5, fibronectin type III domain-containing protein 5, FRCP2Fibronectin type III repeat-containing protein 2
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.