SLCO2A1 Antibody - BSA Free | Novus Biologicals NBP2-13349 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SLCO2A1 Antibody - BSA Free

catalog :

NBP2-13349

quantity :

0.1 ml (also 25 ul)

price :

529 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
de Haan W, Øie C, Benkheil M, Dheedene W, Vinckier S, Coppiello G, et al. Unraveling the transcriptional determinants of liver sinusoidal endothelial cell specialization. Am J Physiol Gastrointest Liver Physiol. 2020;318:G803-G815 pubmed publisher
Cristini A, Ricci G, Britton S, Salimbeni S, Huang S, Marinello J, et al. Dual Processing of R-Loops and Topoisomerase I Induces Transcription-Dependent DNA Double-Strand Breaks. Cell Rep. 2019;28:3167-3181.e6 pubmed publisher
Makharashvili N, Arora S, Yin Y, Fu Q, Wen X, Lee J, et al. Sae2/CtIP prevents R-loop accumulation in eukaryotic cells. elife. 2018;7: pubmed publisher
Andrews A, McCartney H, Errington T, D Andrea A, Macara I. A senataxin-associated exonuclease SAN1 is required for resistance to DNA interstrand cross-links. Nat Commun. 2018;9:2592 pubmed publisher
Cohen S, Puget N, Lin Y, Clouaire T, Aguirrebengoa M, Rocher V, et al. Senataxin resolves RNA:DNA hybrids forming at DNA double-strand breaks to prevent translocations. Nat Commun. 2018;9:533 pubmed publisher
Nguyen H, Yadav T, Giri S, Saez B, Graubert T, Zou L. Functions of Replication Protein A as a Sensor of R Loops and a Regulator of RNaseH1. Mol Cell. 2017;65:832-847.e4 pubmed publisher
Umeno J, Hisamatsu T, Esaki M, Hirano A, Kubokura N, Asano K, et al. A Hereditary Enteropathy Caused by Mutations in the SLCO2A1 Gene, Encoding a Prostaglandin Transporter. PLoS Genet. 2015;11:e1005581 pubmed publisher
Patik I, Kovacsics D, NÃ©met O, Gera M, VÃ¡rady G, Stieger B, et al. Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate. Biochem Pharmacol. 2015;98:649-58 pubmed publisher

product information

master code :

NBP2-13349

SKU :

NBP2-13349

product name :

SLCO2A1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SLCO2A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SLCO2A1. This antibody reacts with human. The SLCO2A1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

SLCO2A1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSP
CHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCP
VPCAH
This antibody was developed against a recombinant protein corresponding to the amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

SLCO2A1

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

OATP2A1member 2, PGTmatrin F/G 1, Prostaglandin transporter, Solute carrier family 21 member 2, solute carrier organic anion transporter family member 2A1, solute carrier organic anion transporter family, member 2A1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage