product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SLC34A1 Antibody - BSA Free
catalog :
NBP2-13328
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
OTI7G9
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 10
Reference
Feger M, Alber J, Strotmann J, Grund A, Leifheit Nestler M, Haffner D, et al. Short-term fasting of mice elevates circulating fibroblast growth factor 23 (FGF23). Acta Physiol (Oxf). 2023;239:e14049 pubmed publisher
Huang B, Zeng Z, Li H, Li Z, Chen X, Guo J, et al. Modeling kidney development, disease, and plasticity with clonal expandable nephron progenitor cells and nephron organoids. bioRxiv. 2023;: pubmed publisher
Shin S, Awuah Boadi E, Bandyopadhyay B. Ablation of TRPC3 compromises bicarbonate and phosphate transporter activity in mice proximal tubular cells. Clin Exp Pharmacol Physiol. 2023;50:247-255 pubmed publisher
Balzer M, Doke T, Yang Y, Aldridge D, Hu H, Mai H, et al. Single-cell analysis highlights differences in druggable pathways underlying adaptive or fibrotic kidney regeneration. Nat Commun. 2022;13:4018 pubmed publisher
Maruyama H, Taguchi A, Mikame M, Lu H, Tada N, Ishijima M, et al. Low bone mineral density due to secondary hyperparathyroidism in the GlatmTg(CAG-A4GALT) mouse model of Fabry disease. FASEB Bioadv. 2020;2:365-381 pubmed publisher
Ter Braake A, Smit A, Bos C, van Herwaarden A, Alkema W, van Essen H, et al. Magnesium prevents vascular calcification in Klotho deficiency. Kidney Int. 2020;97:487-501 pubmed publisher
Mace M, Gravesen E, Nordholm A, Hofman Bang J, Secher T, Olgaard K, et al. Kidney fibroblast growth factor 23 does not contribute to elevation of its circulating levels in uremia. Kidney Int. 2017;92:165-178 pubmed publisher
Suzuki T, Seki S, Hiramoto K, Naganuma E, Kobayashi E, Yamaoka A, et al. Hyperactivation of Nrf2 in early tubular development induces nephrogenic diabetes insipidus. Nat Commun. 2017;8:14577 pubmed publisher
Liu E, Martins J, Raimann A, Chae B, Brooks D, Jorgetti V, et al. 1,25-Dihydroxyvitamin D Alone Improves Skeletal Growth, Microarchitecture, and Strength in a Murine Model of XLH, Despite Enhanced FGF23 Expression. J Bone Miner Res. 2016;31:929-39 pubmed publisher
Robijn S, Vervaet B, D Haese P, Verhulst A. Evaluation of intestinal phosphate binding to improve the safety profile of oral sodium phosphate bowel cleansing. PLoS ONE. 2015;10:e0116590 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP2-13328
SKU :
NBP2-13328
product name :
SLC34A1 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The SLC34A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SLC34A1. This antibody reacts with human,mouse,rat. The SLC34A1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
SLC34A1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLG
PVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVP
KLRQA
This antibody was developed against a recombinant protein corresponding to the amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
SLC34A1
top caption :
Immunocytochemistry/ Immunofluorescence: SLC34A1 Antibody [NBP2-13328]
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, NaPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.