SLC34A1 Antibody - BSA Free | Novus Biologicals NBP2-13328 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SLC34A1 Antibody - BSA Free

catalog :

NBP2-13328

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

OTI7G9

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Feger M, Alber J, Strotmann J, Grund A, Leifheit Nestler M, Haffner D, et al. Short-term fasting of mice elevates circulating fibroblast growth factor 23 (FGF23). Acta Physiol (Oxf). 2023;239:e14049 pubmed publisher
Huang B, Zeng Z, Li H, Li Z, Chen X, Guo J, et al. Modeling kidney development, disease, and plasticity with clonal expandable nephron progenitor cells and nephron organoids. bioRxiv. 2023;: pubmed publisher
Shin S, Awuah Boadi E, Bandyopadhyay B. Ablation of TRPC3 compromises bicarbonate and phosphate transporter activity in mice proximal tubular cells. Clin Exp Pharmacol Physiol. 2023;50:247-255 pubmed publisher
Balzer M, Doke T, Yang Y, Aldridge D, Hu H, Mai H, et al. Single-cell analysis highlights differences in druggable pathways underlying adaptive or fibrotic kidney regeneration. Nat Commun. 2022;13:4018 pubmed publisher
Maruyama H, Taguchi A, Mikame M, Lu H, Tada N, Ishijima M, et al. Low bone mineral density due to secondary hyperparathyroidism in the GlatmTg(CAG-A4GALT) mouse model of Fabry disease. FASEB Bioadv. 2020;2:365-381 pubmed publisher
Ter Braake A, Smit A, Bos C, van Herwaarden A, Alkema W, van Essen H, et al. Magnesium prevents vascular calcification in Klotho deficiency. Kidney Int. 2020;97:487-501 pubmed publisher
Mace M, Gravesen E, Nordholm A, Hofman Bang J, Secher T, Olgaard K, et al. Kidney fibroblast growth factor 23 does not contribute to elevation of its circulating levels in uremia. Kidney Int. 2017;92:165-178 pubmed publisher
Suzuki T, Seki S, Hiramoto K, Naganuma E, Kobayashi E, Yamaoka A, et al. Hyperactivation of Nrf2 in early tubular development induces nephrogenic diabetes insipidus. Nat Commun. 2017;8:14577 pubmed publisher
Liu E, Martins J, Raimann A, Chae B, Brooks D, Jorgetti V, et al. 1,25-Dihydroxyvitamin D Alone Improves Skeletal Growth, Microarchitecture, and Strength in a Murine Model of XLH, Despite Enhanced FGF23 Expression. J Bone Miner Res. 2016;31:929-39 pubmed publisher
Robijn S, Vervaet B, D Haese P, Verhulst A. Evaluation of intestinal phosphate binding to improve the safety profile of oral sodium phosphate bowel cleansing. PLoS ONE. 2015;10:e0116590 pubmed publisher

product information

master code :

NBP2-13328

SKU :

NBP2-13328

product name :

SLC34A1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SLC34A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SLC34A1. This antibody reacts with human,mouse,rat. The SLC34A1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

SLC34A1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLG
PVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVP
KLRQA
This antibody was developed against a recombinant protein corresponding to the amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

SLC34A1

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

559 USD

alt names :

FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, NaPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage