STX17 Antibody - BSA Free | Novus Biologicals NBP1-93968 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

STX17 Antibody - BSA Free

catalog :

NBP1-93968

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

OTI4H1

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Kim T, Jeong J, Park J, Kim S, Heo J, Kang H, et al. miR-150 enhances apoptotic and anti-tumor effects of paclitaxel in paclitaxel-resistant ovarian cancer cells by targeting Notch3. Oncotarget. 2017;8:72788-72800 pubmed publisher
Liao B, Zhou H, Liang H, Li C. Regulation of ERK and AKT pathways by hepatitis B virus X protein via the Notch1 pathway in hepatocellular carcinoma. Int J Oncol. 2017;51:1449-1459 pubmed publisher
Martinet W, Roth L, De Meyer G. Standard Immunohistochemical Assays to Assess Autophagy in Mammalian Tissue. Cells. 2017;6: pubmed publisher
Jeong J, Kang H, Kim T, Kim G, Heo J, Kwon A, et al. MicroRNA-136 inhibits cancer stem cell activity and enhances the anti-tumor effect of paclitaxel against chemoresistant ovarian cancer cells by targeting Notch3. Cancer Lett. 2017;386:168-178 pubmed publisher
Diao J, Liu R, Rong Y, Zhao M, Zhang J, Lai Y, et al. ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes. Nature. 2015;520:563-6 pubmed publisher
Chiou H, Liu S, Lin C, Lee E. Hes-1 SUMOylation by protein inhibitor of activated STAT1 enhances the suppressing effect of Hes-1 on GADD45? expression to increase cell survival. J Biomed Sci. 2014;21:53 pubmed publisher
Maraver A, Fernandez Marcos P, Herranz D, Muñoz Martin M, Gomez Lopez G, Canamero M, et al. Therapeutic effect of ?-secretase inhibition in KrasG12V-driven non-small cell lung carcinoma by derepression of DUSP1 and inhibition of ERK. Cancer Cell. 2012;22:222-34 pubmed publisher
Wang C, Wei Q, Han I, Sato S, Ghanbari Azarnier R, Whetstone H, et al. Hedgehog and Notch signaling regulate self-renewal of undifferentiated pleomorphic sarcomas. Cancer Res. 2012;72:1013-22 pubmed publisher

product information

master code :

NBP1-93968

SKU :

NBP1-93968

product name :

STX17 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The STX17 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to STX17. This antibody reacts with human,mouse. The STX17 Antibody - BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western,Knockdown Validated.

target :

STX17

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDK
LHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKR
MIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQ
PPLTRSMTVGGAFHTTEAEASSQSLTQ
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

STX17

Antibody validation :

Biological Validation

applications :

Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western,Knockdown Validated

USD :

559 USD

alt names :

MGC102796, MGC126613, MGC126615, syntaxin 17, syntaxin-17

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage