product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CAMTA1 Antibody - BSA Free
catalog :
NBP1-93620
quantity :
0.1 ml (also 25 ul)
price :
569 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, proximity ligation assay
more info or order :
citations: 13
Published Application/Species/Sample/DilutionReference
  • proximity ligation assay; rat; loading ...; fig 8c
  • immunocytochemistry; rat; loading ...; fig 8a
Mollet I, Malm H, Wendt A, Orho Melander M, Eliasson L. Integrator of Stress Responses Calmodulin Binding Transcription Activator 1 (Camta1) Regulates miR-212/miR-132 Expression and Insulin Secretion. J Biol Chem. 2016;291:18440-52 pubmed publisher
Lahori M, Dehghani A, Wilson C, Law W, Agaram N, Murali R, et al. Cytopathologic features of epithelioid hemangioendothelioma including touch imprints for rapid on-site evaluation. Cytojournal. 2023;20:29 pubmed publisher
Ravindran A, Said S, Shi M. Thinking Beyond the Marrow: Deceptive Presentation of a Rare Malignant Neoplasm. Mayo Clin Proc. 2022;97:1337-1338 pubmed publisher
Papke D, Sholl L, Doyle L, Fletcher C, Hornick J. Gastroesophageal Glomus Tumors: Clinicopathologic and Molecular Genetic Analysis of 26 Cases With a Proposal for Malignancy Criteria. Am J Surg Pathol. 2022;46:1436-1446 pubmed publisher
Wei H, Zhen T, Tuo Y, Li H, Liang J, Chen S, et al. Clinicopathologic and molecular features of vascular tumors in a series of 118 cases. Am J Transl Res. 2022;14:2939-2951 pubmed
Vazzano J, Patton A, Tinoco G, Iwenofu O. Primary Intranodal Epithelioid Hemangioendothelioma with Molecular Confirmation. Int J Surg Pathol. 2022;30:557-563 pubmed publisher
Luzar B, Ieremia E, Antonescu C, Zhang L, Calonje E. Cutaneous intravascular epithelioid hemangioma. A clinicopathological and molecular study of 21 cases. Mod Pathol. 2020;33:1527-1536 pubmed publisher
Sadler R, Cramer J, Heindl S, Kostidis S, Betz D, Zuurbier K, et al. Short-Chain Fatty Acids Improve Poststroke Recovery via Immunological Mechanisms. J Neurosci. 2020;40:1162-1173 pubmed publisher
Rodet F, Capuz A, Ozcan B, Le Beillan R, Raffo Romero A, Kobeissy F, et al. PC1/3 KD Macrophages Exhibit Resistance to the Inhibitory Effect of IL-10 and a Higher TLR4 Activation Rate, Leading to an Anti-Tumoral Phenotype. Cells. 2019;8: pubmed publisher
Jung H, Kim H, Jang Y, Park C, Ha S. CAMTA-1 Expression in 24 Cases of Hepatic Epithelioid Hemangioendothelioma in a Single Institute: Diagnostic Utility for Differential Diagnosis from Hepatic Angiosarcoma. In Vivo. 2019;33:2293-2297 pubmed publisher
Lotfalla M, Folpe A, Fritchie K, Greipp P, Galliano G, Halling K, et al. Hepatic YAP1-TFE3 Rearranged Epithelioid Hemangioendothelioma. Case Rep Gastrointest Med. 2019;2019:7530845 pubmed publisher
Carmona Fontaine C, Deforet M, Akkari L, Thompson C, Joyce J, Xavier J. Metabolic origins of spatial organization in the tumor microenvironment. Proc Natl Acad Sci U S A. 2017;114:2934-2939 pubmed publisher
Shibuya R, Matsuyama A, Shiba E, Harada H, Yabuki K, Hisaoka M. CAMTA1 is a useful immunohistochemical marker for diagnosing epithelioid haemangioendothelioma. Histopathology. 2015;67:827-35 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-93620
SKU :
NBP1-93620
product name :
CAMTA1 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The CAMTA1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CAMTA1. This antibody reacts with human,rat. The CAMTA1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
CAMTA1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFL
NNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVL
TKEIKTE
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Rat
specificity :
Adeno-Associated Virus (AAV)
gene symbol :
CAMTA1
top caption :
Immunocytochemistry/ Immunofluorescence: CAMTA1 Antibody [NBP1-93620]
accessionNumbers :
Q9Y6Y1
applications :
IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
569 USD
alt names :
calmodulin binding transcription activator 1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.