CAMTA1 Antibody - BSA Free | Novus Biologicals NBP1-93620 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CAMTA1 Antibody - BSA Free

catalog :

NBP1-93620

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, proximity ligation assay

more info or order :

Novus Biologicals product webpage

citations: 13

Published Application/Species/Sample/Dilution	Reference
proximity ligation assay; rat; loading ...; fig 8c immunocytochemistry; rat; loading ...; fig 8a	Mollet I, Malm H, Wendt A, Orho Melander M, Eliasson L. Integrator of Stress Responses Calmodulin Binding Transcription Activator 1 (Camta1) Regulates miR-212/miR-132 Expression and Insulin Secretion. J Biol Chem. 2016;291:18440-52 pubmed publisher
	Lahori M, Dehghani A, Wilson C, Law W, Agaram N, Murali R, et al. Cytopathologic features of epithelioid hemangioendothelioma including touch imprints for rapid on-site evaluation. Cytojournal. 2023;20:29 pubmed publisher
	Ravindran A, Said S, Shi M. Thinking Beyond the Marrow: Deceptive Presentation of a Rare Malignant Neoplasm. Mayo Clin Proc. 2022;97:1337-1338 pubmed publisher
	Papke D, Sholl L, Doyle L, Fletcher C, Hornick J. Gastroesophageal Glomus Tumors: Clinicopathologic and Molecular Genetic Analysis of 26 Cases With a Proposal for Malignancy Criteria. Am J Surg Pathol. 2022;46:1436-1446 pubmed publisher
	Wei H, Zhen T, Tuo Y, Li H, Liang J, Chen S, et al. Clinicopathologic and molecular features of vascular tumors in a series of 118 cases. Am J Transl Res. 2022;14:2939-2951 pubmed
	Vazzano J, Patton A, Tinoco G, Iwenofu O. Primary Intranodal Epithelioid Hemangioendothelioma with Molecular Confirmation. Int J Surg Pathol. 2022;30:557-563 pubmed publisher
	Luzar B, Ieremia E, Antonescu C, Zhang L, Calonje E. Cutaneous intravascular epithelioid hemangioma. A clinicopathological and molecular study of 21 cases. Mod Pathol. 2020;33:1527-1536 pubmed publisher
	Sadler R, Cramer J, Heindl S, Kostidis S, Betz D, Zuurbier K, et al. Short-Chain Fatty Acids Improve Poststroke Recovery via Immunological Mechanisms. J Neurosci. 2020;40:1162-1173 pubmed publisher
	Rodet F, Capuz A, Ozcan B, Le Beillan R, Raffo Romero A, Kobeissy F, et al. PC1/3 KD Macrophages Exhibit Resistance to the Inhibitory Effect of IL-10 and a Higher TLR4 Activation Rate, Leading to an Anti-Tumoral Phenotype. Cells. 2019;8: pubmed publisher
	Jung H, Kim H, Jang Y, Park C, Ha S. CAMTA-1 Expression in 24 Cases of Hepatic Epithelioid Hemangioendothelioma in a Single Institute: Diagnostic Utility for Differential Diagnosis from Hepatic Angiosarcoma. In Vivo. 2019;33:2293-2297 pubmed publisher
	Lotfalla M, Folpe A, Fritchie K, Greipp P, Galliano G, Halling K, et al. Hepatic YAP1-TFE3 Rearranged Epithelioid Hemangioendothelioma. Case Rep Gastrointest Med. 2019;2019:7530845 pubmed publisher
	Carmona Fontaine C, Deforet M, Akkari L, Thompson C, Joyce J, Xavier J. Metabolic origins of spatial organization in the tumor microenvironment. Proc Natl Acad Sci U S A. 2017;114:2934-2939 pubmed publisher
	Shibuya R, Matsuyama A, Shiba E, Harada H, Yabuki K, Hisaoka M. CAMTA1 is a useful immunohistochemical marker for diagnosing epithelioid haemangioendothelioma. Histopathology. 2015;67:827-35 pubmed publisher

product information

master code :

NBP1-93620

SKU :

NBP1-93620

product name :

CAMTA1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CAMTA1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CAMTA1. This antibody reacts with human,rat. The CAMTA1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

CAMTA1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFL
NNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVL
TKEIKTE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Rat

gene symbol :

CAMTA1

accessionNumbers :

Q9Y6Y1

applications :

IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

569 USD

alt names :

calmodulin binding transcription activator 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage