SGLT2/SLC5A2 Antibody - BSA Free | Novus Biologicals NBP1-92384 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SGLT2/SLC5A2 Antibody - BSA Free

catalog :

NBP1-92384

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Shim B, Stokum J, Moyer M, Tsymbalyuk N, Tsymbalyuk O, Keledjian K, et al. Canagliflozin, an Inhibitor of the Na+-Coupled D-Glucose Cotransporter, SGLT2, Inhibits Astrocyte Swelling and Brain Swelling in Cerebral Ischemia. Cells. 2023;12: pubmed publisher
Yu H, Wang M, Yu J, Tang H, Xu Q, Cheng N, et al. Evaluation of the efficacy of Abelmoschus manihot (L.) on diabetic nephropathy by analyzing biomarkers in the glomeruli and proximal and distal convoluted tubules of the kidneys. Front Pharmacol. 2023;14:1215996 pubmed publisher
Herat L, Matthews J, Hibbs M, Rakoczy E, Schlaich M, Matthews V. SGLT1/2 inhibition improves glycemic control and multi-organ protection in type 1 diabetes. iScience. 2023;26:107260 pubmed publisher
Schwertheim S, Alhardan M, Manka P, Sowa J, Canbay A, Schmidt H, et al. Higher pNRF2, SOCS3, IRF3, and RIG1 Tissue Protein Expression in NASH Patients versus NAFL Patients: pNRF2 Expression Is Concomitantly Associated with Elevated Fasting Glucose Levels. J Pers Med. 2023;13: pubmed publisher
Berghaus C, Groh A, Breljak D, Ciarimboli G, Saboli x107 I, Pavenst xe4 dt H, et al. Impact of Pals1 on Expression and Localization of Transporters Belonging to the Solute Carrier Family. Front Mol Biosci. 2022;9:792829 pubmed publisher
Du J, Gu J, Deng J, Kong L, Guo Y, Jin C, et al. The expression and survival significance of sodium glucose transporters in pancreatic cancer. BMC Cancer. 2022;22:116 pubmed publisher
Mitsuhata Y, Abe T, Misaki K, Nakajima Y, Kiriya K, Kawasaki M, et al. Cyst formation in proximal renal tubules caused by dysfunction of the microtubule minus-end regulator CAMSAP3. Sci Rep. 2021;11:5857 pubmed publisher
Chiba Y, Murakami R, Matsumoto K, Wakamatsu K, Nonaka W, Uemura N, et al. Glucose, Fructose, and Urate Transporters in the Choroid Plexus Epithelium. Int J Mol Sci. 2020;21: pubmed publisher
Chiba Y, Sugiyama Y, Nishi N, Nonaka W, Murakami R, Ueno M. Sodium/glucose cotransporter 2 is expressed in choroid plexus epithelial cells and ependymal cells in human and mouse brains. Neuropathology. 2020;40:482-491 pubmed publisher
Dai C, Walker J, Shostak A, Bouchi Y, Poffenberger G, Hart N, et al. Dapagliflozin Does Not Directly Affect Human α or β Cells. Endocrinology. 2020;161: pubmed publisher
Scafoglio C, Villegas B, Abdelhady G, Bailey S, Liu J, Shirali A, et al. Sodium-glucose transporter 2 is a diagnostic and therapeutic target for early-stage lung adenocarcinoma. Sci Transl Med. 2018;10: pubmed publisher

product information

master code :

NBP1-92384

SKU :

NBP1-92384

product name :

SGLT2/SLC5A2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SGLT2/SLC5A2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SGLT2/SLC5A2. This antibody reacts with canine,human,mouse,tenrec. The SGLT2/SLC5A2 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,IF/IHC,Immunohistochemistry-Paraffin.

target :

SGLT2/SLC5A2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRP
RPDSYHLL
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Canine,Human,Mouse,Tenrec

gene symbol :

SLC5A2

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage