Pit1 Antibody - BSA Free | Novus Biologicals NBP1-92273 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Pit1 Antibody - BSA Free

catalog :

NBP1-92273

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 16

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; mouse; fig 3e	Duan S, Sawyer T, Sontz R, Wieland B, Diaz A, Merchant J. GFAP-directed Inactivation of Men1 Exploits Glial Cell Plasticity in Favor of Neuroendocrine Reprogramming. Cell Mol Gastroenterol Hepatol. 2022;14:1025-1051 pubmed publisher
	Chiloiro S, Moroni R, Giampietro A, Angelini F, Gessi M, Lauretti L, et al. The Multibiomarker Acro-TIME Score Predicts fg-SRLs Response: Preliminary Results of a Retrospective Acromegaly Cohort. J Clin Endocrinol Metab. 2024;109:1341-1350 pubmed publisher
	Hong S, Kim S, Lim S, Lee E, Kim S, Ku C, et al. Clinical Relevance of New World Health Organization Classification System for Pituitary Adenomas: A Validation Study With 2-Year Experience. Front Oncol. 2021;11:739290 pubmed publisher
	Tjörnstrand A, Casar Borota O, Heurling K, Scholl M, Gjertsson P, Ragnarsson O, et al. Pre- and postoperative 68 Ga-DOTATOC positron emission tomography for hormone-secreting pituitary neuroendocrine tumours. Clin Endocrinol (Oxf). 2021;: pubmed publisher
	Taniguchi Ponciano K, Peña Martínez E, Silva Román G, Vela Patiño S, Guzmán Ortiz A, Quezada H, et al. Proteomic and Transcriptomic Analysis Identify Spliceosome as a Significant Component of the Molecular Machinery in the Pituitary Tumors Derived from POU1F1- and NR5A1-Cell Lineages. Genes (Basel). 2020;11: pubmed publisher
	Taniguchi Ponciano K, Andonegui Elguera S, Peña Martínez E, Silva Román G, Vela Patiño S, Gómez Apo E, et al. Transcriptome and methylome analysis reveals three cellular origins of pituitary tumors. Sci Rep. 2020;10:19373 pubmed publisher
	Casar Borota O, Boldt H, Engström B, Andersen M, Baussart B, Bengtsson D, et al. Corticotroph Aggressive Pituitary Tumors and Carcinomas Frequently Harbor ATRX Mutations. J Clin Endocrinol Metab. 2021;106:1183-1194 pubmed publisher
	Abboud D, Daly A, Dupuis N, Bahri M, Inoue A, Chevigné A, et al. GPR101 drives growth hormone hypersecretion and gigantism in mice via constitutive activation of Gs and Gq/11. Nat Commun. 2020;11:4752 pubmed publisher
	Neou M, Villa C, Armignacco R, Jouinot A, Raffin Sanson M, Septier A, et al. Pangenomic Classification of Pituitary Neuroendocrine Tumors. Cancer Cell. 2020;37:123-134.e5 pubmed publisher
	Tjörnstrand A, Casar Borota O, Heurling K, Scholl M, Gjertsson P, Himmelman J, et al. Lower 68 Ga-DOTATOC uptake in nonfunctioning pituitary neuroendocrine tumours compared to normal pituitary gland-A proof-of-concept study. Clin Endocrinol (Oxf). 2020;92:222-231 pubmed publisher
	Căpraru O, Gaillard C, Vasiljevic A, Lasolle H, Borson Chazot F, Raverot V, et al. Diagnosis, pathology, and management of TSH-secreting pituitary tumors. A single-center retrospective study of 20 patients from 1981 to 2014. Ann Endocrinol (Paris). 2019;80:216-224 pubmed publisher
	Németh K, Darvasi O, Liko I, Szucs N, Czirjak S, Reiniger L, et al. Comprehensive analysis of circulating microRNAs in plasma of patients with pituitary adenomas. J Clin Endocrinol Metab. 2019;: pubmed publisher
	Scaroni C, Albiger N, Daniele A, Dassie F, Romualdi C, Vazza G, et al. Paradoxical GH Increase During OGTT Is Associated With First-Generation Somatostatin Analog Responsiveness in Acromegaly. J Clin Endocrinol Metab. 2019;104:856-862 pubmed publisher
	Maher M, Roncaroli F, Mendoza N, Meeran K, Canham N, Kosicka Slawinska M, et al. A patient with a germline SDHB mutation presenting with an isolated pituitary macroprolactinoma. Endocrinol Diabetes Metab Case Rep. 2018;2018: pubmed publisher
	Albuquerque R, Carbonara C, Martin R, dos Reis L, do Nascimento C, Arap S, et al. Parathyroidectomy in patients with chronic kidney disease: Impacts of different techniques on the biochemical and clinical evolution of secondary hyperparathyroidism. Surgery. 2018;163:381-387 pubmed publisher
	Ã˜ystese K, Zucknick M, Casar Borota O, Ringstad G, Bollerslev J. Early postoperative growth in non-functioning pituitary adenomas; A tool to tailor safe follow-up. Endocrine. 2017;57:35-45 pubmed publisher

product information

master code :

NBP1-92273

SKU :

NBP1-92273

product name :

Pit1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Pit1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Pit1. This antibody reacts with human,mouse. The Pit1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

Pit1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTIS
IAAKDALERHFGEQNKPSSQEIMRMAE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

POU1F1

Antibody validation :

Independent Anitbodies

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

559 USD

alt names :

CPHD1, GHF1, GHF-1pituitary-specific positive transcription factor 1, Growth hormone factor 1, PIT-1, PIT1pituitary-specific transcription factor 1, POU class 1 homeobox 1, POU domain class 1, transcription factor 1, POU domain, class 1, transcription factor 1, POU1F1a

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage