HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free | Novus Biologicals NBP1-92180 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

catalog :

NBP1-92180

quantity :

0.1 ml (also 25 ul)

price :

519 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Yang Y, Pei T, Hu X, Lu Y, Huang Y, Wan T, et al. Dietary vitamin B3 supplementation induces the antitumor immunity against liver cancer via biased GPR109A signaling in myeloid cell. Cell Rep Med. 2024;5:101718 pubmed publisher
Chen J, Lin T, Zhang S, Yue X, Liu X, Wu C, et al. Niacin/β-hydroxybutyrate regulates milk fat and milk protein synthesis via the GPR109A/Gi/mTORC1 pathway. Food Funct. 2023;14:2642-2656 pubmed publisher
Lee W, Yu H, Tain Y, Wu K, Chuang Y, Chan J. Vinpocetine Ameliorates Metabolic-Syndrome-Associated Bladder Overactivity in Fructose-Fed Rats by Restoring Succinate-Modulated cAMP Levels and Exerting Anti-Inflammatory Effects in the Bladder Detrusor Muscle. Biomedicines. 2022;10: pubmed publisher
Guo W, Liu J, Li W, Ma H, Gong Q, Kan X, et al. Niacin Alleviates Dairy Cow Mastitis by Regulating the GPR109A/AMPK/NRF2 Signaling Pathway. Int J Mol Sci. 2020;21: pubmed publisher
Sun J, Yuan B, Wu Y, Gong Y, Guo W, Fu S, et al. Sodium Butyrate Protects N2a Cells against Aβ Toxicity In Vitro. Mediators Inflamm. 2020;2020:7605160 pubmed publisher
Bullen J, Tchernyshyov I, Holewinski R, Devine L, Wu F, Venkatraman V, et al. Protein kinase A-dependent phosphorylation stimulates the transcriptional activity of hypoxia-inducible factor 1. Sci Signal. 2016;9:ra56 pubmed publisher
Wong T, Chan L, Leung P. Involvement of the Niacin Receptor GPR109a in the LocalControl of Glucose Uptake in Small Intestine of Type 2Diabetic Mice. Nutrients. 2015;7:7543-61 pubmed publisher
Chen L, So W, Li S, Cheng Q, Boucher B, Leung P. Niacin-induced hyperglycemia is partially mediated via niacin receptor GPR109a in pancreatic islets. Mol Cell Endocrinol. 2015;404:56-66 pubmed publisher

product information

master code :

NBP1-92180

SKU :

NBP1-92180

product name :

HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to HM74A/PUMA-G/GPR109A/NIACR1. This antibody reacts with bovine,human,mouse,rat. The HM74A/PUMA-G/GPR109A/NIACR1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

HM74A/PUMA-G/GPR109A/NIACR1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMAN
SGEPWSPSYLGP
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Bovine,Human,Mouse,Rat

gene symbol :

HCAR2

accessionNumbers :

Q8TDS4

applications :

IF/IHC,Western Blot,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

519 USD

alt names :

GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage