product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Myosin 5a Antibody - BSA Free
catalog :
NBP1-92156
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 9
Reference
Lo C, Liu Z, Chen S, Lin F, Berneshawi A, Yu C, et al. Primary cilia formation requires the Leigh syndrome-associated mitochondrial protein NDUFAF2. J Clin Invest. 2024;134: pubmed publisher
Carew J, Cristofaro V, Goyal R, Sullivan M. Differential Myosin 5a splice variants in innervation of pelvic organs. Front Physiol. 2023;14:1304537 pubmed publisher
Jewett C, McCurdy B, O TOOLE E, Stemm Wolf A, Given K, Lin C, et al. Trisomy 21 induces pericentrosomal crowding delaying primary ciliogenesis and mouse cerebellar development. elife. 2023;12: pubmed publisher
Rivera Molina F, Xi Z, Reales E, Wang B, Toomre D. Exocyst complex mediates recycling of internal cilia. Curr Biol. 2021;31:5580-5589.e5 pubmed publisher
Stuck M, Chong W, Liao J, Pazour G. Rab34 is necessary for early stages of intracellular ciliogenesis. Curr Biol. 2021;31:2887-2894.e4 pubmed publisher
Fan J, You L, Wang W, Huang W, Chu C, Chi Y, et al. Lamin A-mediated nuclear lamina integrity is required for proper ciliogenesis. EMBO Rep. 2020;21:e49680 pubmed publisher
Cuenca A, Insinna C, Zhao H, John P, Weiss M, Lu Q, et al. The C7orf43/TRAPPC14 component links the TRAPPII complex to Rabin8 for preciliary vesicle tethering at the mother centriole during ciliogenesis. J Biol Chem. 2019;294:15418-15434 pubmed publisher
Lo C, Lin I, Yang T, Huang Y, Tanos B, Chou P, et al. Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation. J Cell Biol. 2019;218:3489-3505 pubmed publisher
Reynier M, Allart S, Goudouneche D, Moga A, Serre G, Simon M, et al. The Actin-Based Motor Myosin Vb Is Crucial to Maintain Epidermal Barrier Integrity. J Invest Dermatol. 2019;139:1430-1438 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-92156
SKU :
NBP1-92156
product name :
Myosin 5a Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Myosin 5a Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myosin 5a. This antibody reacts with human,mouse. The Myosin 5a Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.
target :
Myosin 5a
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKT
VRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPV
NIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVN
LIPG
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
MYO5A
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156]
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
Dilute myosin heavy chain, non-muscle, GS1myosin, heavy polypeptide kinase, MYH12myosin-12, MYO5, Myosin heavy chain 12, myosin V, myosin VA (heavy chain 12, myoxin), myosin VA (heavy polypeptide 12, myoxin), Myosin-12, myosin-Va, Myoxin, MYR12
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.