Myosin 5a Antibody - BSA Free | Novus Biologicals NBP1-92156 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Myosin 5a Antibody - BSA Free

catalog :

NBP1-92156

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Lo C, Liu Z, Chen S, Lin F, Berneshawi A, Yu C, et al. Primary cilia formation requires the Leigh syndrome-associated mitochondrial protein NDUFAF2. J Clin Invest. 2024;134: pubmed publisher
Jewett C, McCurdy B, O TOOLE E, Stemm Wolf A, Given K, Lin C, et al. Trisomy 21 induces pericentrosomal crowding delaying primary ciliogenesis and mouse cerebellar development. elife. 2023;12: pubmed publisher
Rivera Molina F, Xi Z, Reales E, Wang B, Toomre D. Exocyst complex mediates recycling of internal cilia. Curr Biol. 2021;31:5580-5589.e5 pubmed publisher
Stuck M, Chong W, Liao J, Pazour G. Rab34 is necessary for early stages of intracellular ciliogenesis. Curr Biol. 2021;31:2887-2894.e4 pubmed publisher
Fan J, You L, Wang W, Huang W, Chu C, Chi Y, et al. Lamin A-mediated nuclear lamina integrity is required for proper ciliogenesis. EMBO Rep. 2020;21:e49680 pubmed publisher
Cuenca A, Insinna C, Zhao H, John P, Weiss M, Lu Q, et al. The C7orf43/TRAPPC14 component links the TRAPPII complex to Rabin8 for preciliary vesicle tethering at the mother centriole during ciliogenesis. J Biol Chem. 2019;294:15418-15434 pubmed publisher
Lo C, Lin I, Yang T, Huang Y, Tanos B, Chou P, et al. Phosphorylation of CEP83 by TTBK2 is necessary for cilia initiation. J Cell Biol. 2019;218:3489-3505 pubmed publisher
Reynier M, Allart S, Goudouneche D, Moga A, Serre G, Simon M, et al. The Actin-Based Motor Myosin Vb Is Crucial to Maintain Epidermal Barrier Integrity. J Invest Dermatol. 2019;139:1430-1438 pubmed publisher

product information

master code :

NBP1-92156

SKU :

NBP1-92156

product name :

Myosin 5a Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Myosin 5a Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Myosin 5a. This antibody reacts with human,mouse. The Myosin 5a Antibody - BSA Free has been validated for the following applications: IF/IHC,Knockdown Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Myosin 5a

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKT
VRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPV
NIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVN
LIPG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

MYO5A

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Knockdown Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

Dilute myosin heavy chain, non-muscle, GS1myosin, heavy polypeptide kinase, MYH12myosin-12, MYO5, Myosin heavy chain 12, myosin V, myosin VA (heavy chain 12, myoxin), myosin VA (heavy polypeptide 12, myoxin), Myosin-12, myosin-Va, Myoxin, MYR12

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage