product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MUC5B Antibody - BSA Free
catalog :
NBP1-92151
quantity :
0.1 ml
price :
549 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
808E10.01
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 21
Reference
Cao W, Li J, Che L, Yang R, Wu Z, Hu G, et al. Single-cell transcriptomics reveals e-cigarette vapor-induced airway epithelial remodeling and injury. Respir Res. 2024;25:353 pubmed publisher
Ye Y, Chen D, Liu M, Luo Y, Chen H, Zeng H, et al. Autologous Airway Basal Cell Transplantation Alleviates Airway Epithelium Defect in Recurrent Benign Tracheal Stenosis. Stem Cells Transl Med. 2023;12:838-848 pubmed publisher
Takahashi J, Mizutani T, Sugihara H, Nagata S, Kato S, Hiraguri Y, et al. Suspension culture in a rotating bioreactor for efficient generation of human intestinal organoids. Cell Rep Methods. 2022;2:100337 pubmed publisher
Ueda Y, Mogami H, Kawamura Y, Takakura M, Inohaya A, Yasuda E, et al. Cervical MUC5B and MUC5AC are Barriers to Ascending Pathogens During Pregnancy. J Clin Endocrinol Metab. 2022;107:3010-3021 pubmed publisher
Tan Y, Flynn W, Sivajothi S, Luo D, Bozal S, Dav xe9 M, et al. Single-cell analysis of endometriosis reveals a coordinated transcriptional programme driving immunotolerance and angiogenesis across eutopic and ectopic tissues. Nat Cell Biol. 2022;24:1306-1318 pubmed publisher
Yin W, Liontos A, Koepke J, Ghoul M, Mazzocchi L, Liu X, et al. An essential function for autocrine hedgehog signaling in epithelial proliferation and differentiation in the trachea. Development. 2022;149: pubmed publisher
Carrer M, Crosby J, Sun G, Zhao C, Damle S, Kuntz S, et al. Antisense Oligonucleotides Targeting Jagged 1 Reduce House Dust Mite-induced Goblet Cell Metaplasia in the Adult Murine Lung. Am J Respir Cell Mol Biol. 2020;63:46-56 pubmed publisher
Chabrol E, Thépaut M, Dezutter Dambuyant C, Vivès C, Marcoux J, Kahn R, et al. Alteration of the langerin oligomerization state affects Birbeck granule formation. Biophys J. 2015;108:666-77 pubmed publisher
De Jesus M, Ostroff G, Levitz S, Bartling T, Mantis N. A population of Langerin-positive dendritic cells in murine Peyer's patches involved in sampling β-glucan microparticles. PLoS ONE. 2014;9:e91002 pubmed publisher
Debeer S, Le Luduec J, Kaiserlian D, Laurent P, Nicolas J, Dubois B, et al. Comparative histology and immunohistochemistry of porcine versus human skin. Eur J Dermatol. 2013;23:456-66 pubmed publisher
Luckashenak N, Wähe A, Breit K, Brakebusch C, Brocker T. Rho-family GTPase Cdc42 controls migration of Langerhans cells in vivo. J Immunol. 2013;190:27-35 pubmed publisher
Hitzler M, Majdic O, Heine G, Worm M, Ebert G, Luch A, et al. Human Langerhans cells control Th cells via programmed death-ligand 1 in response to bacterial stimuli and nickel-induced contact allergy. PLoS ONE. 2012;7:e46776 pubmed publisher
Iram N, Mildner M, Prior M, Petzelbauer P, Fiala C, Hacker S, et al. Age-related changes in expression and function of Toll-like receptors in human skin. Development. 2012;139:4210-9 pubmed publisher
Schwingshackl P, Obermoser G, Nguyen V, Fritsch P, Sepp N, Romani N. Distribution and maturation of skin dendritic cell subsets in two forms of cutaneous T-cell lymphoma: mycosis fungoides and Sézary syndrome. Acta Derm Venereol. 2012;92:269-75 pubmed publisher
Segura E, Valladeau Guilemond J, Donnadieu M, Sastre Garau X, Soumelis V, Amigorena S. Characterization of resident and migratory dendritic cells in human lymph nodes. J Exp Med. 2012;209:653-60 pubmed publisher
Rochereau N, Verrier B, Pin J, Genin C, Paul S. Phenotypic localization of distinct DC subsets in mouse Peyer Patch. Vaccine. 2011;29:3655-61 pubmed publisher
Bobr A, Olvera Gomez I, Igyarto B, Haley K, Hogquist K, Kaplan D. Acute ablation of Langerhans cells enhances skin immune responses. J Immunol. 2010;185:4724-8 pubmed publisher
de Jong M, de Witte L, Taylor M, Geijtenbeek T. Herpes simplex virus type 2 enhances HIV-1 susceptibility by affecting Langerhans cell function. J Immunol. 2010;185:1633-41 pubmed publisher
Nfon C, Dawson H, Toka F, Golde W. Langerhans cells in porcine skin. Vet Immunol Immunopathol. 2008;126:236-47 pubmed publisher
Douillard P, Stoitzner P, Tripp C, Clair Moninot V, Ait Yahia S, McLellan A, et al. Mouse lymphoid tissue contains distinct subsets of langerin/CD207 dendritic cells, only one of which represents epidermal-derived Langerhans cells. J Invest Dermatol. 2005;125:983-94 pubmed
Valladeau J, Clair Moninot V, Dezutter Dambuyant C, Pin J, Kissenpfennig A, Mattei M, et al. Identification of mouse langerin/CD207 in Langerhans cells and some dendritic cells of lymphoid tissues. J Immunol. 2002;168:782-92 pubmed
product information
master code :
NBP1-92151
SKU :
NBP1-92151
product name :
MUC5B Antibody - BSA Free
unit size :
0.1 ml
description :
The MUC5B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to MUC5B. This antibody reacts with human. The MUC5B Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
MUC5B
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIR
KAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVRE
VCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVL
A
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
MUC5B
Antibody validation :
Orthogonal Validation
applications :
IF/IHC,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
549 USD
alt names :
high molecular weight salivary mucin MG1, mucin 5, subtype B, tracheobronchial, mucin 5B, oligomeric mucus/gel-forming, sublingual gland mucin, tracheobronchial
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.