GTF2IRD1 Antibody - BSA Free | Novus Biologicals NBP1-91973 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

GTF2IRD1 Antibody - BSA Free

catalog :

NBP1-91973

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 5

Reference
Nygaard K, Maloney S, Swift R, McCullough K, Wagner R, Fass S, et al. Extensive characterization of a Williams syndrome murine model shows Gtf2ird1-mediated rescue of select sensorimotor tasks, but no effect on enhanced social behavior. Genes Brain Behav. 2023;22:e12853 pubmed publisher
Kopp N, Nygaard K, Liu Y, McCullough K, Maloney S, Gabel H, et al. Functions of Gtf2i and Gtf2ird1 in the developing brain: transcription, DNA binding and long-term behavioral consequences. Hum Mol Genet. 2020;29:1498-1519 pubmed publisher
Marcelin G, Da Cunha C, Gamblin C, Suffee N, Rouault C, Leclerc A, et al. Autophagy inhibition blunts PDGFRA adipose progenitors' cell-autonomous fibrogenic response to high-fat diet. Autophagy. 2020;:1-11 pubmed publisher
Kopp N, McCullough K, Maloney S, Dougherty J. Gtf2i and Gtf2ird1 mutation do not account for the full phenotypic effect of the Williams syndrome critical region in mouse models. Hum Mol Genet. 2019;: pubmed publisher
Hasegawa Y, Ikeda K, Chen Y, Alba D, Stifler D, Shinoda K, et al. Repression of Adipose Tissue Fibrosis through a PRDM16-GTF2IRD1 Complex Improves Systemic Glucose Homeostasis. Cell Metab. 2018;27:180-194.e6 pubmed publisher

product information

master code :

NBP1-91973

SKU :

NBP1-91973

product name :

GTF2IRD1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The GTF2IRD1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to GTF2IRD1. This antibody reacts with human,mouse,rat. The GTF2IRD1 Antibody - BSA Free has been validated for the following applications: Western Blot,Chromatin Immunoprecipitation (ChIP),Immunohistochemistry,Immunohistochemistry-Paraffin,Knockout Validated,Immunocytochemistry/ Immunofluorescence.

target :

GTF2IRD1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFT
KDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMS
EDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSE
EMTDSMPGHLPSEDSGYGMEMLTD
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

GTF2IRD1

applications :

Western Blot,Chromatin Immunoprecipitation (ChIP),Immunohistochemistry,Immunohistochemistry-Paraffin,Knockout Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

BEN, CREAM1, General transcription factor III, general transcription factor II-I repeat domain-containing protein 1, GTF2I repeat domain containing 1, GTF2I repeat domain-containing protein 1, GTF3GTF2I repeat domain-containing 1, hMusTRD1alpha1, Muscle TFII-I repeat domain-containing protein 1, muscle TFII-I repeat domain-containing protein 1 alpha 1, MusTRD1, MusTRD1/BEN, MUSTRD1general transcription factor 3, RBAP2WBSCR12binding factor for early enhancer, Slow-muscle-fiber enhancer-binding protein, USE B1-binding protein, WBS, WBSCR11, Williams-Beuren syndrome chromosomal region 11 protein, Williams-Beuren syndrome chromosomal region 12 protein, Williams-Beuren syndrome chromosome region 11

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage