product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CRBN Antibody - BSA Free
catalog :
NBP1-91810
quantity :
0.1 ml (also 25 ul)
price :
569 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
more info or order :
citations: 32
Published Application/Species/Sample/DilutionReference
  • western blot; human; loading ...; fig 4
Girardini M, Maniaci C, Hughes S, Testa A, Ciulli A. Cereblon versus VHL: Hijacking E3 ligases against each other using PROTACs. Bioorg Med Chem. 2019;27:2466-2479 pubmed publisher
  • western blot; human; 1:1000; loading ...; fig 1c
Jian Y, Gao W, Geng C, Zhou H, Leng Y, Li Y, et al. Arsenic trioxide potentiates sensitivity of multiple myeloma cells to lenalidomide by upregulating cereblon expression levels. Oncol Lett. 2017;14:3243-3248 pubmed publisher
Lee S, Kim H, Woo Y, Kim J, Kim H, Park J, et al. UBX-390: A Novel Androgen Receptor Degrader for Therapeutic Intervention in Prostate Cancer. Adv Sci (Weinh). 2024;11:e2400398 pubmed publisher
Jiang B, Weinstock D, Donovan K, Sun H, Wolfe A, Amaka S, et al. ITK degradation to block T cell receptor signaling and overcome therapeutic resistance in T cell lymphomas. Cell Chem Biol. 2023;30:383-393.e6 pubmed publisher
Mehta S, Buyanbat A, Kai Y, Karayel Ö, Goldman S, Seruggia D, et al. Temporal resolution of gene derepression and proteome changes upon PROTAC-mediated degradation of BCL11A protein in erythroid cells. Cell Chem Biol. 2022;29:1273-1287.e8 pubmed publisher
Shen C, Nayak A, Neitzel L, Yang F, Li B, Williams C, et al. The Casein kinase 1α agonist pyrvinium attenuates Wnt-mediated CK1α degradation via interaction with the E3 ubiquitin ligase component Cereblon. J Biol Chem. 2022;298:102227 pubmed publisher
Yamamoto T, Nakayama J, Yamamoto Y, Kuroda M, Hattori Y, Ochiya T. SORT1/LAMP2-mediated Extracellular Vesicle Secretion and Cell Adhesion Are Linked to Lenalidomide Resistance in Multiple Myeloma. Blood Adv. 2022;: pubmed publisher
Mori T, Verma R, Nakamoto Matsubara R, Siu K, Panaroni C, Fulzele K, et al. Low NCOR2 levels in multiple myeloma patients drive multidrug resistance via MYC upregulation. Blood Cancer J. 2021;11:194 pubmed publisher
Wu X, Yang X, Xiong Y, Li R, Ito T, Ahmed T, et al. Distinct CDK6 complexes determine tumor cell response to CDK4/6 inhibitors and degraders. Nat Cancer. 2021;2:429-443 pubmed publisher
Shen C, Nayak A, Neitzel L, Adams A, Silver Isenstadt M, Sawyer L, et al. The E3 ubiquitin ligase component, Cereblon, is an evolutionarily conserved regulator of Wnt signaling. Nat Commun. 2021;12:5263 pubmed publisher
Powell C, Du G, Bushman J, He Z, Zhang T, Fischer E, et al. Selective degradation-inducing probes for studying cereblon (CRBN) biology. RSC Med Chem. 2021;12:1381-1390 pubmed publisher
Misiewicz Krzeminska I, de Ramón C, Corchete L, Krzeminski P, Rojas E, Isidro I, et al. Quantitative expression of Ikaros, IRF4, and PSMD10 proteins predicts survival in VRD-treated patients with multiple myeloma. Blood Adv. 2020;4:6023-6033 pubmed publisher
Powell C, Du G, Che J, He Z, Donovan K, Yue H, et al. Selective Degradation of GSPT1 by Cereblon Modulators Identified via a Focused Combinatorial Library. ACS Chem Biol. 2020;15:2722-2730 pubmed publisher
Martínez Høyer S, Deng Y, Parker J, Jiang J, Mo A, Docking T, et al. Loss of lenalidomide-induced megakaryocytic differentiation leads to therapy resistance in del(5q) myelodysplastic syndrome. Nat Cell Biol. 2020;22:526-533 pubmed publisher
Jain P, Ballaré C, Blanco E, Vizan P, Di Croce L. PHF19 mediated regulation of proliferation and invasiveness in prostate cancer cells. elife. 2020;9: pubmed publisher
de Wispelaere M, Du G, Donovan K, Zhang T, Eleuteri N, Yuan J, et al. Small molecule degraders of the hepatitis C virus protease reduce susceptibility to resistance mutations. Nat Commun. 2019;10:3468 pubmed publisher
Kumar R, Evans T. Activation-Induced Cytidine Deaminase Regulates Fibroblast Growth Factor/Extracellular Signal-Regulated Kinases Signaling to Achieve the Naïve Pluripotent State During Reprogramming. Stem Cells. 2019;37:1003-1017 pubmed publisher
Zoppi V, Hughes S, Maniaci C, Testa A, Gmaschitz T, Wieshofer C, et al. Iterative design and optimization of initially inactive Proteolysis Targeting Chimeras (PROTACs) identify VZ185 as a potent, fast and selective von Hippel-Lindau (VHL)-based dual degrader probe of BRD9 and BRD7. J Med Chem. 2018;: pubmed publisher
Sievers Q, Petzold G, Bunker R, Renneville A, Słabicki M, Liddicoat B, et al. Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN. Science. 2018;362: pubmed publisher
Yen Y, Hsieh W, Tsai Y, Lü Y, Liau E, Hsu H, et al. Dlk1-Dio3 locus-derived lncRNAs perpetuate postmitotic motor neuron cell fate and subtype identity. elife. 2018;7: pubmed publisher
Donovan K, An J, Nowak R, Yuan J, Fink E, Berry B, et al. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. elife. 2018;7: pubmed publisher
Perino M, van Mierlo G, Karemaker I, van Genesen S, Vermeulen M, Marks H, et al. MTF2 recruits Polycomb Repressive Complex 2 by helical-shape-selective DNA binding. Nat Genet. 2018;50:1002-1010 pubmed publisher
Olson C, Jiang B, Erb M, Liang Y, Doctor Z, Zhang Z, et al. Pharmacological perturbation of CDK9 using selective CDK9 inhibition or degradation. Nat Chem Biol. 2017;: pubmed publisher
Schneider E, Staffas A, Röhner L, Malmberg E, Ashouri A, Krowiorz K, et al. Micro-ribonucleic acid-155 is a direct target of Meis1, but not a driver in acute myeloid leukemia. Haematologica. 2018;103:246-255 pubmed publisher
Huang H, Dobrovolsky D, Paulk J, Yang G, Weisberg E, Doctor Z, et al. A Chemoproteomic Approach to Query the Degradable Kinome Using a Multi-kinase Degrader. Cell Chem Biol. 2018;25:88-99.e6 pubmed publisher
Basu M, Zhu J, Lahaye S, Majumdar U, Jiao K, Han Z, et al. Epigenetic mechanisms underlying maternal diabetes-associated risk of congenital heart disease. JCI Insight. 2017;2: pubmed publisher
Qu Y, Yang Q, Liu J, Shi B, Ji M, Li G, et al. c-Myc is Required for BRAFV600E-Induced Epigenetic Silencing by H3K27me3 in Tumorigenesis. Theranostics. 2017;7:2092-2107 pubmed publisher
An J, Ponthier C, Sack R, Seebacher J, Stadler M, Donovan K, et al. pSILAC mass spectrometry reveals ZFP91 as IMiD-dependent substrate of the CRL4CRBN ubiquitin ligase. Nat Commun. 2017;8:15398 pubmed publisher
Jin H, Oda H, Chen P, Yang C, Zhou X, Kang S, et al. Differential Sensitivity of Target Genes to Translational Repression by miR-17~92. PLoS Genet. 2017;13:e1006623 pubmed publisher
Fantini D, Huang S, Asara J, Bagchi S, Raychaudhuri P. Chromatin association of XRCC5/6 in the absence of DNA damage depends on the XPE gene product DDB2. Mol Biol Cell. 2017;28:192-200 pubmed publisher
Cooper S, Grijzenhout A, Underwood E, Ancelin K, Zhang T, Nesterova T, et al. Jarid2 binds mono-ubiquitylated H2A lysine 119 to mediate crosstalk between Polycomb complexes PRC1 and PRC2. Nat Commun. 2016;7:13661 pubmed publisher
Yoon S, Foley J, Baker J. HEB associates with PRC2 and SMAD2/3 to regulate developmental fates. Nat Commun. 2015;6:6546 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-91810
SKU :
NBP1-91810
product name :
CRBN Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The CRBN Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CRBN. This antibody reacts with human,mouse,rat. The CRBN Antibody - BSA Free has been validated for the following applications: Western Blot,Simple Western,Knockout Validated,Single Cell Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.
target :
CRBN
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGR
TLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSM
VRNLIQKDRTFAVLAYSNVQERE
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
CRBN
review stars :
4
Antibody validation :
Knockout/Knockdown
top caption :
Western Blot: CRBN Antibody [NBP1-91810]
accessionNumbers :
Q96SW2
applications :
Western Blot,Simple Western,Knockout Validated,Single Cell Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
USD :
569 USD
alt names :
cereblon, DKFZp781K0715, MGC27358, MRT2A, non-syndromic, autosomal recessive, 2A, protein cereblon, protein x 0001
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.