BRP44L Antibody - BSA Free | Novus Biologicals NBP1-91706 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

BRP44L Antibody - BSA Free

catalog :

NBP1-91706

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Li M, Plecit xe1 Hlavat xe1 L, Dobrinskikh E, McKeon B, Gandjeva A, Riddle S, et al. SIRT3 Is a Critical Regulator of Mitochondrial Function of Fibroblasts in Pulmonary Hypertension. Am J Respir Cell Mol Biol. 2023;: pubmed publisher
Liu Y, Yuan Y, Yan Y, Wang R, Wang Z, Liu X, et al. Mitochondrial pyruvate carrier 1 alleviates hypoxic-ischemic brain injury in rats. Life Sci. 2023;325:121686 pubmed publisher
You J, Lee J, Roh J. Mitochondrial pyruvate carrier 1 regulates ferroptosis in drug-tolerant persister head and neck cancer cells via epithelial-mesenchymal transition. Cancer Lett. 2021;507:40-54 pubmed publisher
Li Y, Wang K, Song N, Hou K, Che X, Zhou Y, et al. Activation of IGF-1R pathway and NPM-ALK G1269A mutation confer resistance to crizotinib treatment in NPM-ALK positive lymphoma. Invest New Drugs. 2019;: pubmed publisher
Kim J, Yu L, Chen W, Xu Y, Wu M, Todorova D, et al. Wild-Type p53 Promotes Cancer Metabolic Switch by Inducing PUMA-Dependent Suppression of Oxidative Phosphorylation. Cancer Cell. 2019;35:191-203.e8 pubmed publisher
Li X, Han G, Li X, Kan Q, Fan Z, Li Y, et al. Mitochondrial pyruvate carrier function determines cell stemness and metabolic reprogramming in cancer cells. Oncotarget. 2017;8:46363-46380 pubmed publisher
Nitta T, Koike H, Miyao T, Miyazawa Y, Kato H, Furuya Y, et al. YM155 Reverses Statin Resistance in Renal Cancer by Reducing Expression of Survivin. Anticancer Res. 2017;37:75-80 pubmed
Li X, Ji Y, Han G, Li X, Fan Z, Li Y, et al. MPC1 and MPC2 expressions are associated with favorable clinical outcomes in prostate cancer. BMC Cancer. 2016;16:894 pubmed
Konstantakou E, Voutsinas G, Velentzas A, Basogianni A, Paronis E, Balafas E, et al. 3-BrPA eliminates human bladder cancer cells with highly oncogenic signatures via engagement of specific death programs and perturbation of multiple signaling and metabolic determinants. Mol Cancer. 2015;14:135 pubmed publisher

product information

master code :

NBP1-91706

SKU :

NBP1-91706

product name :

BRP44L Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The BRP44L Antibody - BSA Free from Novus is a rabbit polyclonal antibody to BRP44L. This antibody reacts with human,mouse. The BRP44L Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockout Validated.

target :

BRP44L

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIA
AINDMKKSPEIISGR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

MPC1

Antibody validation :

Knockout/Knockdown

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockout Validated

USD :

559 USD

alt names :

brain protein 44-like, brain protein 44-like protein, CGI-129, dJ68L15.3, HSPC040 protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage