ARP10 Antibody - BSA Free | Novus Biologicals NBP1-91682 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ARP10 Antibody - BSA Free

catalog :

NBP1-91682

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; 1:200; loading ...; fig 5a	Starrett G, Luengas E, McCann J, Ebrahimi D, Temiz N, Love R, et al. The DNA cytosine deaminase APOBEC3H haplotype I likely contributes to breast and lung cancer mutagenesis. Nat Commun. 2016;7:12918 pubmed publisher
	Carpenter M, Temiz N, Ibrahim M, Jarvis M, Brown M, Argyris P, et al. Mutational impact of APOBEC3A and APOBEC3B in a human cell line and comparisons to breast cancer. PLoS Genet. 2023;19:e1011043 pubmed publisher
	Ikeda T, Shimizu R, Nasser H, Carpenter M, CHENG A, Brown W, et al. APOBEC3 degradation is the primary function of HIV-1 Vif determining virion infectivity in the myeloid cell line THP-1. MBio. 2023;14:e0078223 pubmed publisher
	Ikeda T, Shimizu R, Nasser H, Carpenter M, CHENG A, Brown W, et al. APOBEC3 degradation is the primary function of HIV-1 Vif for virus replication in the myeloid cell line THP-1. bioRxiv. 2023;: pubmed publisher
	Law E, Levin Klein R, Jarvis M, Kim H, Argyris P, Carpenter M, et al. APOBEC3A catalyzes mutation and drives carcinogenesis in vivo. J Exp Med. 2020;217: pubmed publisher
	Wang J, Becker J, Shi K, Lauer K, Salamango D, Aihara H, et al. The Role of RNA in HIV-1 Vif-Mediated Degradation of APOBEC3H. J Mol Biol. 2019;431:5019-5031 pubmed publisher
	Ebrahimi D, Richards C, Carpenter M, Wang J, Ikeda T, Becker J, et al. Genetic and mechanistic basis for APOBEC3H alternative splicing, retrovirus restriction, and counteraction by HIV-1 protease. Nat Commun. 2018;9:4137 pubmed publisher
	Salamango D, Becker J, McCann J, CHENG A, Demir O, Amaro R, et al. APOBEC3H Subcellular Localization Determinants Define Zipcode for Targeting HIV-1 for Restriction. Mol Cell Biol. 2018;38: pubmed publisher
	Shaban N, Shi K, Lauer K, Carpenter M, Richards C, Salamango D, et al. The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism. Mol Cell. 2018;69:75-86.e9 pubmed publisher
	Ooms M, Letko M, Simon V. The Structural Interface between HIV-1 Vif and Human APOBEC3H. J Virol. 2017;91: pubmed publisher
	Wang L, Liang J, Leung P. The ACE2/Ang-(1-7)/Mas Axis Regulates the Development of Pancreatic Endocrine Cells in Mouse Embryos. PLoS ONE. 2015;10:e0128216 pubmed publisher

product information

master code :

NBP1-91682

SKU :

NBP1-91682

product name :

ARP10 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The ARP10 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ARP10. This antibody reacts with human. The ARP10 Antibody - BSA Free has been validated for the following applications: Western Blot,SDS-Page,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

ARP10

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGL
RLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKM
LEELDKNSRAIKRRLERIKQS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

theoretical molecular weight :

24 kDa

gene symbol :

APOBEC3H

accessionNumbers :

Q6NTF7

applications :

Western Blot,SDS-Page,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

APOBEC-related protein 10, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H, ARP-10, ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H, DNA dC- dU-editing enzyme APOBEC-3H, EC 3.5.4.-

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage