product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ARP10 Antibody - BSA Free
catalog :
NBP1-91682
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 11
Published Application/Species/Sample/DilutionReference
  • immunocytochemistry; human; 1:200; loading ...; fig 5a
Starrett G, Luengas E, McCann J, Ebrahimi D, Temiz N, Love R, et al. The DNA cytosine deaminase APOBEC3H haplotype I likely contributes to breast and lung cancer mutagenesis. Nat Commun. 2016;7:12918 pubmed publisher
Carpenter M, Temiz N, Ibrahim M, Jarvis M, Brown M, Argyris P, et al. Mutational impact of APOBEC3A and APOBEC3B in a human cell line and comparisons to breast cancer. PLoS Genet. 2023;19:e1011043 pubmed publisher
Ikeda T, Shimizu R, Nasser H, Carpenter M, CHENG A, Brown W, et al. APOBEC3 degradation is the primary function of HIV-1 Vif determining virion infectivity in the myeloid cell line THP-1. MBio. 2023;14:e0078223 pubmed publisher
Ikeda T, Shimizu R, Nasser H, Carpenter M, CHENG A, Brown W, et al. APOBEC3 degradation is the primary function of HIV-1 Vif for virus replication in the myeloid cell line THP-1. bioRxiv. 2023;: pubmed publisher
Law E, Levin Klein R, Jarvis M, Kim H, Argyris P, Carpenter M, et al. APOBEC3A catalyzes mutation and drives carcinogenesis in vivo. J Exp Med. 2020;217: pubmed publisher
Wang J, Becker J, Shi K, Lauer K, Salamango D, Aihara H, et al. The Role of RNA in HIV-1 Vif-Mediated Degradation of APOBEC3H. J Mol Biol. 2019;431:5019-5031 pubmed publisher
Ebrahimi D, Richards C, Carpenter M, Wang J, Ikeda T, Becker J, et al. Genetic and mechanistic basis for APOBEC3H alternative splicing, retrovirus restriction, and counteraction by HIV-1 protease. Nat Commun. 2018;9:4137 pubmed publisher
Salamango D, Becker J, McCann J, CHENG A, Demir O, Amaro R, et al. APOBEC3H Subcellular Localization Determinants Define Zipcode for Targeting HIV-1 for Restriction. Mol Cell Biol. 2018;38: pubmed publisher
Shaban N, Shi K, Lauer K, Carpenter M, Richards C, Salamango D, et al. The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism. Mol Cell. 2018;69:75-86.e9 pubmed publisher
Ooms M, Letko M, Simon V. The Structural Interface between HIV-1 Vif and Human APOBEC3H. J Virol. 2017;91: pubmed publisher
Wang L, Liang J, Leung P. The ACE2/Ang-(1-7)/Mas Axis Regulates the Development of Pancreatic Endocrine Cells in Mouse Embryos. PLoS ONE. 2015;10:e0128216 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-91682
SKU :
NBP1-91682
product name :
ARP10 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The ARP10 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ARP10. This antibody reacts with human. The ARP10 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,SDS-Page,Immunocytochemistry/ Immunofluorescence.
target :
ARP10
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGL
RLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKM
LEELDKNSRAIKRRLERIKQS
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
theoretical molecular weight :
24 kDa
gene symbol :
APOBEC3H
review stars :
5
top caption :
Western Blot: ARP10 Antibody [NBP1-91682]
accessionNumbers :
Q6NTF7
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,SDS-Page,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
APOBEC-related protein 10, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H, ARP-10, ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H, DNA dC- dU-editing enzyme APOBEC-3H, EC 3.5.4.-
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.