product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
catalog :
NBP1-90309
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
QBEND/10
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
Novus Biologicals product webpage
citations: 7
Reference
Guan S, Darmstädter M, Xu C, Rosenecker J. In Vitro Investigations on Optimizing and Nebulization of IVT-mRNA Formulations for Potential Pulmonary-Based Alpha-1-Antitrypsin Deficiency Treatment. Pharmaceutics. 2021;13: pubmed publisher
Aoki H, Yamashita M, Hashita T, Ogami K, Hoshino S, Iwao T, et al. Efficient differentiation and purification of human induced pluripotent stem cell-derived endothelial progenitor cells and expansion with the use of inhibitors of ROCK, TGF-β, and GSK3β. Heliyon. 2020;6:e03493 pubmed publisher
Furuya H, Chan O, Hokutan K, Tsukikawa Y, Chee K, Kozai L, et al. Prognostic Significance of Lymphocyte Infiltration and a Stromal Immunostaining of a Bladder Cancer Associated Diagnostic Panel in Urothelial Carcinoma. Diagnostics (Basel). 2019;10: pubmed publisher
Connolly B, Isaacs C, Cheng L, Asrani K, Subramanian R. SERPINA1 mRNA as a Treatment for Alpha-1 Antitrypsin Deficiency. J Nucleic Acids. 2018;2018:8247935 pubmed publisher
Shen S, Sanchez M, Blomenkamp K, Corcoran E, Marco E, Yudkoff C, et al. Amelioration of Alpha-1 Antitrypsin Deficiency Diseases with Genome Editing in Transgenic Mice. Hum Gene Ther. 2018;: pubmed publisher
AbuSamra D, Al Kilani A, Hamdan S, Sakashita K, Gadhoum S, Merzaban J. Quantitative Characterization of E-selectin Interaction with Native CD44 and P-selectin Glycoprotein Ligand-1 (PSGL-1) Using a Real Time Immunoprecipitation-based Binding Assay. J Biol Chem. 2015;290:21213-30 pubmed publisher
Kwon C, Park H, Choi J, Lee J, Kim H, Jo H, et al. Snail and serpinA1 promote tumor progression and predict prognosis in colorectal cancer. Oncotarget. 2015;6:20312-26 pubmed
product information
master code :
NBP1-90309
SKU :
NBP1-90309
product name :
Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Serpin A1/alpha 1-Antitrypsin. This antibody reacts with human. The Serpin A1/alpha 1-Antitrypsin Antibody - BSA Free has been validated for the following applications: Simple Western,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.
target :
Serpin A1/alpha 1-Antitrypsin
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSP
VSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIH
EGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLE
DVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
SERPINA1
Antibody validation :
Independent Anitbodies
applications :
Simple Western,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry
USD :
559 USD
alt names :
A1A, AATMGC23330, Alpha-1 protease inhibitor, Alpha-1-antiproteinase, alpha-1-antitrypsin, antitrypsin), member 1, member 1, PIMGC9222, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, serine (or cysteine) proteinase inhibitor, clade A, member 1, Serpin A1, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
Novus Biologicals product webpage
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.