beta Sarcoglycan Antibody - BSA Free | Novus Biologicals NBP1-90300 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

beta Sarcoglycan Antibody - BSA Free

catalog :

NBP1-90300

quantity :

0.1 ml (also 25 ul)

price :

519 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; 1:1000; fig 6	Vanhoutte D, Schips T, Kwong J, Davis J, Tjondrokoesoemo A, Brody M, et al. Thrombospondin expression in myofibers stabilizes muscle membranes. elife. 2016;5: pubmed publisher
	Vanhoutte D, Schips T, Minerath R, Huo J, Kavuri N, Prasad V, et al. Thbs1 regulates skeletal muscle mass in a TGFβ-Smad2/3-ATF4-dependent manner. Cell Rep. 2024;43:114149 pubmed publisher
	Sidky S, Ingalls C, Lowe D, Baumann C. Membrane Proteins Increase with the Repeated Bout Effect. Med Sci Sports Exerc. 2022;54:57-66 pubmed publisher
	Baumann C, Lindsay A, Sidky S, Ervasti J, Warren G, Lowe D. Contraction-Induced Loss of Plasmalemmal Electrophysiological Function Is Dependent on the Dystrophin Glycoprotein Complex. Front Physiol. 2021;12:757121 pubmed publisher
	Brody M, Vanhoutte D, Schips T, Boyer J, Bakshi C, Sargent M, et al. Defective Flux of Thrombospondin-4 through the Secretory Pathway Impairs Cardiomyocyte Membrane Stability and Causes Cardiomyopathy. Mol Cell Biol. 2018;38: pubmed publisher
	Pozsgai E, Griffin D, Heller K, Mendell J, Rodino Klapac L. Systemic AAV-Mediated β-Sarcoglycan Delivery Targeting Cardiac and Skeletal Muscle Ameliorates Histological and Functional Deficits in LGMD2E Mice. Mol Ther. 2017;25:855-869 pubmed publisher
	Pozsgai E, Griffin D, Heller K, Mendell J, Rodino Klapac L. β-Sarcoglycan gene transfer decreases fibrosis and restores force in LGMD2E mice. Gene Ther. 2016;23:57-66 pubmed publisher

product information

master code :

NBP1-90300

SKU :

NBP1-90300

product name :

beta Sarcoglycan Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The beta Sarcoglycan Antibody - BSA Free from Novus is a rabbit polyclonal antibody to beta Sarcoglycan. This antibody reacts with human,mouse. The beta Sarcoglycan Antibody - BSA Free has been validated for the following applications: Western Blot,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

beta Sarcoglycan

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGS
GDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

SGCB

Antibody validation :

Orthogonal Validation

accessionNumbers :

Q16585

applications :

Western Blot,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

519 USD

alt names :

43 kDa dystrophin-associated glycoprotein, 43DAG, A3bbeta-SG, beta-sarcoglycan, beta-sarcoglycan(43kD dystrophin-associated glycoprotein), Beta-SG, LGMD2E, limb girdle muscular dystrophy 2E (non-linked families), sarcoglycan, beta (43kD dystrophin-associated glycoprotein), sarcoglycan, beta (43kDa dystrophin-associated glycoprotein), SGC

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage