Podoplanin Antibody - BSA Free | Novus Biologicals NBP1-90211 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Podoplanin Antibody - BSA Free

catalog :

NBP1-90211

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Francipane M, Han B, Lagasse E. Host Lymphotoxin-β Receptor Signaling Is Crucial for Angiogenesis of Metanephric Tissue Transplanted into Lymphoid Sites. Am J Pathol. 2020;190:252-269 pubmed publisher
Drosos I, Pavlaki M, Ortega Carrillo M, Kourkouli A, Buschmann K, Konstantinou F, et al. Increased Lymphangiogenesis and Lymphangiogenic Growth Factor Expression in Perivascular Adipose Tissue of Patients with Coronary Artery Disease. J Clin Med. 2019;8: pubmed publisher
Carbonell C, Ulsamer A, Vivori C, Papasaikas P, Böttcher R, Joaquin M, et al. Functional Network Analysis Reveals the Relevance of SKIIP in the Regulation of Alternative Splicing by p38 SAPK. Cell Rep. 2019;27:847-859.e6 pubmed publisher
Otto M, Blatt S, Pabst A, Mandic R, Schwarz J, Neff A, et al. Influence of buffy coat-derived putative endothelial progenitor cells on tumor growth and neovascularization in oral squamous cell carcinoma xenografts. Clin Oral Investig. 2019;: pubmed publisher
Tan K, Haelterman N, Kwartler C, Regalado E, Lee P, Nagarkar Jaiswal S, et al. Ari-1 Regulates Myonuclear Organization Together with Parkin and Is Associated with Aortic Aneurysms. Dev Cell. 2018;45:226-244.e8 pubmed publisher
Saribas A, White M, Safak M. Structure-based release analysis of the JC virus agnoprotein regions: A role for the hydrophilic surface of the major alpha helix domain in release. J Cell Physiol. 2018;233:2343-2359 pubmed publisher
Louveau A, Smirnov I, Keyes T, Eccles J, Rouhani S, Peske J, et al. Structural and functional features of central nervous system lymphatic vessels. Nature. 2015;523:337-41 pubmed publisher
Tejedor J, Tilgner H, Iannone C, GuigÃ³ R, ValcÃ¡rcel J. Role of six single nucleotide polymorphisms, risk factors in coronary disease, in OLR1 alternative splicing. RNA. 2015;21:1187-202 pubmed publisher

product information

master code :

NBP1-90211

SKU :

NBP1-90211

product name :

Podoplanin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Podoplanin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Podoplanin. This antibody reacts with human,mouse. The Podoplanin Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry.

target :

Podoplanin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RLPRVWEARAPSLSGAPAPTPPAPPPSRSSRLGLWPRCF
LIFPQLRILLLGPQESNNSTGTMWKVSALLFVLGSASLW
VLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTS
EDRYKSGLTTLVATSVNS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

PDPN

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry

USD :

569 USD

alt names :

36-KD, aggrus, Gp36, GP40, HT1A-1, hT1alpha-1, hT1alpha-2, lung type I cell membrane associated glycoprotein, lung type-I cell membrane-associated glycoprotein (T1A-2), OTS 8, OTS8, PA2.26 antigen, podoplanin, T1A, T1-alpha

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage