Alix Antibody - BSA Free | Novus Biologicals NBP1-90201 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Alix Antibody - BSA Free

catalog :

NBP1-90201

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Krause G, Kirchner P, Stiller B, Morozova K, Díaz A, Chen K, et al. Molecular determinants of the crosstalk between endosomal microautophagy and chaperone-mediated autophagy. Cell Rep. 2023;42:113529 pubmed publisher
Blommer J, Pitcher T, Mustapic M, Eren E, Yao P, Vreones M, et al. Extracellular vesicle biomarkers for cognitive impairment in Parkinson's disease. Brain. 2022;: pubmed publisher
Busch D, Zhang Y, Kumar A, Huhn S, Du Z, Liu R. Identification of RNA content of CHO-derived extracellular vesicles from a production process. J Biotechnol. 2022;348:36-46 pubmed publisher
Aiello A, Giannessi F, Percario Z, Fecchi K, Arenaccio C, Leone S, et al. HIV-1 Nef Protein Affects Cytokine and Extracellular Vesicles Production in the GEN2.2 Plasmacytoid Dendritic Cell Line. Viruses. 2021;14: pubmed publisher
Yao P, Eren E, Goetzl E, Kapogiannis D. Mitochondrial Electron Transport Chain Protein Abnormalities Detected in Plasma Extracellular Vesicles in Alzheimer's Disease. Biomedicines. 2021;9: pubmed publisher
Carlomagno C, Giannasi C, Niada S, Bedoni M, Gualerzi A, Brini A. Raman Fingerprint of Extracellular Vesicles and Conditioned Media for the Reproducibility Assessment of Cell-Free Therapeutics. Front Bioeng Biotechnol. 2021;9:640617 pubmed publisher
Millan C, Prause L, Vallmajo Martin Q, Hensky N, Eberli D. Extracellular Vesicles from 3D Engineered Microtissues Harbor Disease-Related Cargo Absent in EVs from 2D Cultures. Adv Healthc Mater. 2021;:e2002067 pubmed publisher
Morris C, Durand S, Jalinot P. Decreased expression of the translation factor eIF3e induces senescence in breast cancer cells via suppression of PARP1 and activation of mTORC1. Oncotarget. 2021;12:649-664 pubmed publisher
Mansur R, Delgado Peraza F, Subramaniapillai M, Lee Y, Iacobucci M, Nasri F, et al. Exploring brain insulin resistance in adults with bipolar depression using extracellular vesicles of neuronal origin. J Psychiatr Res. 2021;133:82-92 pubmed publisher
Nogueras Ortiz C, Mahairaki V, Delgado Peraza F, Das D, Avgerinos K, Eren E, et al. Astrocyte- and Neuron-Derived Extracellular Vesicles from Alzheimer's Disease Patients Effect Complement-Mediated Neurotoxicity. Cells. 2020;9: pubmed publisher
Beckwith K, Beckwith M, Ullmann S, S xe6 tra R, Kim H, Marstad A, et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection. Nat Commun. 2020;11:2270 pubmed publisher

product information

master code :

NBP1-90201

SKU :

NBP1-90201

product name :

Alix Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Alix Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Alix. This antibody reacts with human. The Alix Antibody - BSA Free has been validated for the following applications: Simple Western,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

Alix

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLA
SLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQL
IKELPELLQRNREILDESLRLLDEEEATDND
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

PDCD6IP

Antibody validation :

Knockout/Knockdown

applications :

Simple Western,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

549 USD

alt names :

AIP1DRIP4, ALG-2 interacting protein 1, ALG-2 interacting protein X, ALG-2-interacting protein 1, alinx, ALIX, apoptosis-linked gene 2-interacting protein X, dopamine receptor interacting protein 4, HP95, KIAA1375, MGC17003, PDCD6-interacting protein, programmed cell death 6 interacting protein, programmed cell death 6-interacting protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage