product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Annexin A10 Antibody - BSA Free
catalog :
NBP1-90156
quantity :
0.1 ml (also 25 ul)
price :
569 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 31
Reference
Herrera L xf3 pez E, Guerrero Escalera D, Aguirre Maldonado I, L xf3 pez Hern xe1 ndez A, Montero H, Guti xe9 rrez Nava M, et al. Annexins A2 and A5 are potential early biomarkers of hepatocarcinogenesis. Sci Rep. 2023;13:6948 pubmed publisher
Isidro R, Abukhiran I, Dunseth C, Gosse M, Humble R, Pelletier D, et al. Strong Annexin A10 Expression Supports a Pancreatic Primary and Combined Annexin A10, Claudin 18, and SOX2 Expression Supports an Esophagogastric Origin in Carcinomas of Unknown Primary. Am J Surg Pathol. 2023;47:440-452 pubmed publisher
Kobayashi G, Hayashi T, Sentani K, Ikeda K, Babasaki T, Shigematsu Y, et al. ANXA10 Expression Is Inversely Associated with Tumor Stage, Grade, and TP53 Expression in Upper and Lower Urothelial Carcinoma. Pathobiology. 2022;:1-10 pubmed publisher
Ishikawa A, Kuraoka K, Zaitsu J, Saito A, Kuwai T, Tazawa H, et al. Transcriptomic Analysis of Annexin A10 and Chemosensitivity in Gastric Adenocarcinoma Cells. Anticancer Res. 2022;42:1707-1717 pubmed publisher
Chezar K, Minoo P. Appendiceal sessile serrated lesions are distinct from their right-sided colonic counterparts and may be precursors for appendiceal mucinous neoplasms. Hum Pathol. 2022;122:40-49 pubmed publisher
Ishikawa A, Kuraoka K, Zaitsu J, Saito A, Yamaguchi A, Kuwai T, et al. High Annexin A10 expression is correlated with poor prognosis in pancreatic ductal adenocarcinoma. Histol Histopathol. 2021;:18397 pubmed publisher
Singh H, Ha K, Hornick J, Madha S, Cejas P, Jajoo K, et al. Hybrid Stomach-Intestinal Chromatin States Underlie Human Barrett's Metaplasia. Gastroenterology. 2021;161:924-939.e11 pubmed publisher
Ishikawa A, Kuraoka K, Zaitsu J, Saito A, Kuwai T, Shimizu Y, et al. Annexin A10 Expression Is Associated With Poor Prognosis in Small Bowel Adenocarcinoma. Anticancer Res. 2021;41:1349-1355 pubmed publisher
Ueno T, Miura Y, Osawa H, Tabata K, Lefor A, Yamamoto H. Duodenal sessile serrated adenoma/polyp with characteristic endoscopic and pathologic features. Clin J Gastroenterol. 2021;14:531-537 pubmed publisher
Ishikawa A, Kuraoka K, Zaitsu J, Saito A, Kuwai T, Suzuki T, et al. Loss of Annexin A10 Expression Is Associated with Poor Prognosis in Early Gastric Cancer. Acta Histochem Cytochem. 2020;53:113-119 pubmed publisher
Marquet B, Marchal Bressenot A, Fichel C, Bouland N, Barbe C, Bouche O, et al. Expression of the Serrated Markers Annexin A10 or Gremlin1 in Colonic Adenocarcinomas: Morphology and Prognostic Values. Pathol Oncol Res. 2020;26:2509-2521 pubmed publisher
Tanaka Y, Eizuka M, Uesugi N, Kawasaki K, Yamano H, Suzuki H, et al. Traditional serrated adenoma has two distinct genetic pathways for molecular tumorigenesis with potential neoplastic progression. J Gastroenterol. 2020;55:846-857 pubmed publisher
Koh M, Shin D, Lee S, Hwang C, Lee H, Kim A, et al. Gastric-type gene expression and phenotype in non-terminal respiratory unit type adenocarcinoma of the lung with invasive mucinous adenocarcinoma morphology. Histopathology. 2020;76:898-905 pubmed publisher
Okur M, Lee J, Osmani W, Kimura R, Demarest T, Croteau D, et al. Cockayne syndrome group A and B proteins function in rRNA transcription through nucleolin regulation. Nucleic Acids Res. 2020;48:2473-2485 pubmed publisher
Ishikawa A, Sakamoto N, Honma R, Taniyama D, Fukada K, Hattori T, et al. Annexin A10 is involved in the induction of pancreatic duodenal homeobox‑1 in gastric cancer tissue, cells and organoids. Oncol Rep. 2020;43:581-590 pubmed publisher
Kodaira H, Koma Y, Hosono M, Higashino N, Suemune K, Nishio M, et al. ANXA10 induction by interaction with tumor-associated macrophages promotes the growth of esophageal squamous cell carcinoma. Pathol Int. 2019;69:135-147 pubmed publisher
Hoffmann F, Umbreit C, Krüger T, Pelzel D, Ernst G, Kniemeyer O, et al. Identification of Proteomic Markers in Head and Neck Cancer Using MALDI-MS Imaging, LC-MS/MS, and Immunohistochemistry. Proteomics Clin Appl. 2019;13:e1700173 pubmed publisher
Sugai T, Eizuka M, Fujita Y, Kawasaki K, Yamamoto E, Ishida K, et al. Molecular Profiling Based on KRAS/BRAF Mutation, Methylation, and Microsatellite Statuses in Serrated Lesions. Dig Dis Sci. 2018;63:2626-2638 pubmed publisher
Banerjee S, Aponte Diaz D, Yeager C, Sharma S, Ning G, Oh H, et al. Hijacking of multiple phospholipid biosynthetic pathways and induction of membrane biogenesis by a picornaviral 3CD protein. PLoS Pathog. 2018;14:e1007086 pubmed publisher
Boulagnon Rombi C, Schneider C, Leandri C, Jeanne A, Grybek V, Bressenot A, et al. LRP1 expression in colon cancer predicts clinical outcome. Oncotarget. 2018;9:8849-8869 pubmed publisher
Macaron C, Lopez R, Pai R, Burke C. Expression of Annexin A10 in Serrated Polyps Predicts the Development of Metachronous Serrated Polyps. Clin Transl Gastroenterol. 2016;7:e205 pubmed publisher
Park O, Park J, Yu M, An H, Ko J, Kim Y. Identification and molecular characterization of cellular factors required for glucocorticoid receptor-mediated mRNA decay. Genes Dev. 2016;30:2093-2105 pubmed
Corne T, Sieprath T, Vandenbussche J, Mohammed D, Te Lindert M, Gevaert K, et al. Deregulation of focal adhesion formation and cytoskeletal tension due to loss of A-type lamins. Cell Adh Migr. 2017;11:447-463 pubmed publisher
Robijns J, Molenberghs F, Sieprath T, Corne T, Verschuuren M, De Vos W. In silico synchronization reveals regulators of nuclear ruptures in lamin A/C deficient model cells. Sci Rep. 2016;6:30325 pubmed publisher
Väyrynen S, Väyrynen J, Klintrup K, Makela J, Tuomisto A, Mäkinen M. Ectopic crypt foci in conventional and serrated colorectal polyps. J Clin Pathol. 2016;69:1063-1069 pubmed publisher
Leaderer D, Cashman S, Kumar Singh R. Topical application of a G-Quartet aptamer targeting nucleolin attenuates choroidal neovascularization in a model of age-related macular degeneration. Exp Eye Res. 2015;140:171-178 pubmed publisher
Bae J, Kim J, Rhee Y, Cho N, Kim T, Kang G. Annexin A10 expression in colorectal cancers with emphasis on the serrated neoplasia pathway. World J Gastroenterol. 2015;21:9749-57 pubmed publisher
Sieprath T, Corne T, Nooteboom M, Grootaert C, Rajkovic A, Buysschaert B, et al. Sustained accumulation of prelamin A and depletion of lamin A/C both cause oxidative stress and mitochondrial dysfunction but induce different cell fates. Nucleus. 2015;6:236-46 pubmed publisher
Vermezovic J, Adamowicz M, Santarpia L, Rustighi A, Forcato M, Lucano C, et al. Notch is a direct negative regulator of the DNA-damage response. Nat Struct Mol Biol. 2015;22:417-24 pubmed publisher
Kim J, Kim K, Rhee Y, Bae J, Cho N, Lee H, et al. Gastric-type expression signature in serrated pathway-associated colorectal tumors. Hum Pathol. 2015;46:643-56 pubmed publisher
Sajanti S, Väyrynen J, Sirniö P, Klintrup K, Mäkelä J, Tuomisto A, et al. Annexin A10 is a marker for the serrated pathway of colorectal carcinoma. Virchows Arch. 2015;466:5-12 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-90156
SKU :
NBP1-90156
product name :
Annexin A10 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Annexin A10 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Annexin A10. This antibody reacts with human,mouse. The Annexin A10 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western.
target :
Annexin A10
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMR
EAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGY
TDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
theoretical molecular weight :
37 kDa
gene symbol :
ANXA10
review stars :
5
Antibody validation :
Orthogonal Validation
top caption :
Annexin A10 Antibody - BSA Free Immunohistochemistry: Annexin A10 Antibody - BSA Free [NBP1-90156]
accessionNumbers :
Q9UJ72
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western
USD :
569 USD
alt names :
annexin 14, annexin A10, annexin-10, annexin-14, ANX14Annexin-10
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.