Annexin A3 Antibody - BSA Free | Novus Biologicals NBP1-90155 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Annexin A3 Antibody - BSA Free

catalog :

NBP1-90155

quantity :

0.1 ml (also 25 ul)

price :

499 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, western blot knockout validation

more info or order :

Novus Biologicals product webpage

citations: 5

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; human; loading ...; fig 6a immunohistochemistry; human; loading ...; fig s2-2a immunohistochemistry; mouse; loading ...; fig s2-2a	Hendley A, Rao A, Leonhardt L, Ashe S, Smith J, Giacometti S, et al. Single-cell transcriptome analysis defines heterogeneity of the murine pancreatic ductal tree. elife. 2021;10: pubmed publisher
	de Klerk E, Xiao Y, Emfinger C, Keller M, Berrios D, Loconte V, et al. Loss of ZNF148 enhances insulin secretion in human pancreatic β cells. JCI Insight. 2023;8: pubmed publisher
	Kaufman O, Lee K, Martin M, Rothhämel S, Marlow F. rbpms2 functions in Balbiani body architecture and ovary fate. PLoS Genet. 2018;14:e1007489 pubmed publisher
	Zampedri C, Tinoco Cuellar M, Carrillo Rosas S, Diaz Tellez A, Ramos Balderas J, Pelegri F, et al. Zebrafish P54 RNA helicases are cytoplasmic granule residents that are required for development and stress resilience. Biol Open. 2016;5:1473-1484 pubmed publisher
	Dinets A, Pernemalm M, Kjellin H, Sviatoha V, Sofiadis A, Juhlin C, et al. Differential protein expression profiles of cyst fluid from papillary thyroid carcinoma and benign thyroid lesions. PLoS ONE. 2015;10:e0126472 pubmed publisher

product information

master code :

NBP1-90155

SKU :

NBP1-90155

product name :

Annexin A3 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Annexin A3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Annexin A3. This antibody reacts with human. The Annexin A3 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Annexin A3

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDE
SLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRS
FPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIV
NCVRNTPAFLAERLHRALKGIGTD
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

ANXA3

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

499 USD

alt names :

35-alpha calcimedin, annexin A3,1,2-cyclic-inositol-phosphate phosphodiesterase, Annexin III, annexin-3, calcimedin 35-alpha, Lipocortin III, PAP-III, Placental anticoagulant protein III, placental anticoagulant protein III, calcimedin 35-alpha

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage