CD39/ENTPD1 Antibody - BSA Free | Novus Biologicals NBP1-90071 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CD39/ENTPD1 Antibody - BSA Free

catalog :

NBP1-90071

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Pang L, Ng K, Liu J, Yeung W, Zhu J, Chiu T, et al. Plasmacytoid dendritic cells recruited by HIF-1α/eADO/ADORA1 signaling induce immunosuppression in hepatocellular carcinoma. Cancer Lett. 2021;522:80-92 pubmed publisher
Lu H, Xie Y, Tran L, Lan J, Yang Y, Murugan N, et al. Chemotherapy-induced S100A10 recruits KDM6A to facilitate OCT4-mediated breast cancer stemness. J Clin Invest. 2020;: pubmed publisher
Huang M, Wang Q, Long F, Di Y, Wang J, Zhun Zhu Y, et al. Jmjd3 regulates inflammasome activation and aggravates DSS-induced colitis in mice. FASEB J. 2020;34:4107-4119 pubmed publisher
Luo X, Yang D, Wu W, Long F, Xiao C, Qin M, et al. Critical role of histone demethylase Jumonji domain-containing protein 3 in the regulation of neointima formation following vascular injury. Cardiovasc Res. 2018;114:1894-1906 pubmed publisher
Liu S, Wang X, Pan L, Wu W, Yang D, Qin M, et al. Endogenous hydrogen sulfide regulates histone demethylase JMJD3-mediated inflammatory response in LPS-stimulated macrophages and in a mouse model of LPS-induced septic shock. Biochem Pharmacol. 2018;149:153-162 pubmed publisher
Taube J, Sphyris N, Johnson K, Reisenauer K, Nesbit T, Joseph R, et al. The H3K27me3-demethylase KDM6A is suppressed in breast cancer stem-like cells, and enables the resolution of bivalency during the mesenchymal-epithelial transition. Oncotarget. 2017;8:65548-65565 pubmed publisher
Luo T, Dunphy P, McBride J. Ehrlichia chaffeensis Tandem Repeat Effector Targets Differentially Influence Infection. Front Cell Infect Microbiol. 2017;7:178 pubmed publisher
Smith S, Xu Z, Novitskaya T, Zhang B, Chepurko E, Pu X, et al. Impact of cardiac-specific expression of CD39 on myocardial infarct size in mice. Life Sci. 2017;179:54-59 pubmed publisher
Boudreaux M, Koehler J, Habecker P, Del Piero F. Evaluation of the genes encoding CD39/NTPDase-1 and CD39L1/NTPDase-2 in horses with and without abnormal hemorrhage and in horses with pathologic evidence of exercise-induced pulmonary hemorrhage. Vet Clin Pathol. 2015;44:617-25 pubmed publisher
Cinti A, De Giorgi M, Chisci E, Arena C, Galimberti G, Farina L, et al. Simultaneous Overexpression of Functional Human HO-1, E5NT and ENTPD1 Protects Murine Fibroblasts against TNF-Î±-Induced Injury In Vitro. PLoS ONE. 2015;10:e0141933 pubmed publisher
Hayes G, Cairns B, Levashova Z, Chinn L, Perez M, Theunissen J, et al. CD39 is a promising therapeutic antibody target for the treatment of soft tissue sarcoma. Am J Transl Res. 2015;7:1181-8 pubmed

product information

master code :

NBP1-90071

SKU :

NBP1-90071

product name :

CD39/ENTPD1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CD39/ENTPD1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CD39/ENTPD1. This antibody reacts with equine,human,mouse,porcine. The CD39/ENTPD1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Flow Cytometry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence.

target :

CD39/ENTPD1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

GVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERARE
VIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVE
RSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQK
TRWFS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Equine,Human,Mouse,Porcine

gene symbol :

ENTPD1

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Flow Cytometry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

ATPDase, CD39 antigen, CD39EC 3.6.1.5, DKFZp686D194, DKFZp686I093, EC 3.6.1, Ecto-apyrase, Ecto-ATP diphosphohydrolase 1, Ecto-ATPase 1, Ecto-ATPDase 1, ectonucleoside triphosphate diphosphohydrolase 1, FLJ40921, FLJ40959, Lymphoid cell activation antigen, NTPDase 1, NTPDase-1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage