Ataxin-2 Antibody - BSA Free | Novus Biologicals NBP1-90063 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Ataxin-2 Antibody - BSA Free

catalog :

NBP1-90063

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

OX-50

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Zhu Q, Hsu Y, Lassen F, MacDonald B, Stead S, Malolepsza E, et al. Protein interaction networks in the vasculature prioritize genes and pathways underlying coronary artery disease. Commun Biol. 2024;7:87 pubmed publisher
Zeballos C M, Moore H, Smith T, Powell J, Ahsan N, Zhang S, et al. Mitigating a TDP-43 proteinopathy by targeting ataxin-2 using RNA-targeting CRISPR effector proteins. Nat Commun. 2023;14:6492 pubmed publisher
Rodriguez C, Bechek S, Jones G, Nakayama L, Akiyama T, Kim G, et al. Targeting RTN4/NoGo-Receptor reduces levels of ALS protein ataxin-2. Cell Rep. 2022;41:111505 pubmed publisher
Kim G, Nakayama L, Blum J, Akiyama T, Boeynaems S, Chakraborty M, et al. Genome-wide CRISPR screen reveals v-ATPase as a drug target to lower levels of ALS protein ataxin-2. Cell Rep. 2022;41:111508 pubmed publisher
Larocca T, Mariani A, Watkins L, Link C. TDP-43 knockdown causes innate immune activation via protein kinase R in astrocytes. Neurobiol Dis. 2019;:104514 pubmed publisher
Husain S, Ginawi I, Bashir A, Kfoury H, Al Johani T, Hagar H, et al. Focal and segmental glomerulosclerosis in murine models: a histological and ultrastructural characterization with immunohistochemistry correlation of glomerular CD44 and WT1 expression. Ultrastruct Pathol. 2018;42:430-439 pubmed publisher
Abraham K, Chan J, Salvi J, Ho B, Hall A, Vidya E, et al. Intersection of calorie restriction and magnesium in the suppression of genome-destabilizing RNA-DNA hybrids. Nucleic Acids Res. 2016;44:8870-8884 pubmed
Lee S, Duncan D, Echevarria F, McLaughlin W, Hatcher J, Sappington R. Pressure-Induced Alterations in PEDF and PEDF-R Expression: Implications for Neuroprotective Signaling in Glaucoma. J Clin Exp Ophthalmol. 2015;6: pubmed
Gesierich S, Berezovskiy I, Ryschich E, Zoller M. Systemic induction of the angiogenesis switch by the tetraspanin D6.1A/CO-029. Cancer Res. 2006;66:7083-94 pubmed
Bonnema H, Popa E, van Timmeren M, van Wachem P, de Leij L, van Luyn M. Distribution patterns of the membrane glycoprotein CD44 during the foreign-body reaction to a degradable biomaterial in rats and mice. J Biomed Mater Res A. 2003;64:502-8 pubmed

product information

master code :

NBP1-90063

SKU :

NBP1-90063

product name :

Ataxin-2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Ataxin-2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Ataxin-2. This antibody reacts with human,mouse. The Ataxin-2 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Ataxin-2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSP
VIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYAC
PKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPH
PQPSATPTGQQQSQHGGSHPAPS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

ATXN2

Antibody validation :

Independent Anitbodies

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

ataxin 2, ataxin 2), ataxin-2, ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, SCA2FLJ46772, Spinocerebellar ataxia type 2 protein, TNRC13, trinucleotide repeat containing 13, Trinucleotide repeat-containing gene 13 protein

storage :

Store at 4C short term. Store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage