product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
EYS/RP25 Antibody - BSA Free
catalog :
NBP1-90038
quantity :
0.1 ml (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, zebrafish
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 11
Reference
Sato K, Liu Y, Yamashita T, Ohuchi H. The medaka mutant deficient in eyes shut homolog exhibits opsin transport defects and enhanced autophagy in retinal photoreceptors. Cell Tissue Res. 2023;391:249-267 pubmed publisher
Liu Y, Rittershaus J, Yu M, Sager R, Hu H. Deletion of POMT2 in Zebrafish Causes Degeneration of Photoreceptors. Int J Mol Sci. 2022;23: pubmed publisher
Schellens R, de Vrieze E, Graave P, Broekman S, Nagel Wolfrum K, Peters T, et al. Zebrafish as a Model to Evaluate a CRISPR/Cas9-Based Exon Excision Approach as a Future Treatment Option for EYS-Associated Retinitis Pigmentosa. Int J Mol Sci. 2021;22: pubmed publisher
Kim J, Park J, Shin S, Lim B, Go H. Neo-Fs Index: A Novel Immunohistochemical Biomarker Panel Predicts Survival and Response to Anti-Angiogenetic Agents in Clear Cell Renal Cell Carcinoma. Cancers (Basel). 2021;13: pubmed publisher
Nishiguchi K, Miya F, Mori Y, Fujita K, Akiyama M, Kamatani T, et al. A hypomorphic variant in EYS detected by genome-wide association study contributes toward retinitis pigmentosa. Commun Biol. 2021;4:140 pubmed publisher
Liu Y, Cao S, Yu M, Hu H. TMEM216 Deletion Causes Mislocalization of Cone Opsin and Rhodopsin and Photoreceptor Degeneration in Zebrafish. Invest Ophthalmol Vis Sci. 2020;61:24 pubmed publisher
Liu Y, Yu M, Shang X, Nguyen M, Balakrishnan S, Sager R, et al. Eyes shut homolog (EYS) interacts with matriglycan of O-mannosyl glycans whose deficiency results in EYS mislocalization and degeneration of photoreceptors. Sci Rep. 2020;10:7795 pubmed publisher
Messchaert M, Dona M, Broekman S, Peters T, Corral Serrano J, Slijkerman R, et al. Eyes shut homolog is important for the maintenance of photoreceptor morphology and visual function in zebrafish. PLoS ONE. 2018;13:e0200789 pubmed publisher
Abbuehl J, Tatárová Z, Held W, Huelsken J. Long-Term Engraftment of Primary Bone Marrow Stromal Cells Repairs Niche Damage and Improves Hematopoietic Stem Cell Transplantation. Cell Stem Cell. 2017;21:241-255.e6 pubmed publisher
Lu Z, Hu X, Liu F, Soares D, Liu X, Yu S, et al. Ablation of EYS in zebrafish causes mislocalisation of outer segment proteins, F-actin disruption and cone-rod dystrophy. Sci Rep. 2017;7:46098 pubmed publisher
Yu M, Liu Y, Li J, Natale B, Cao S, Wang D, et al. Eyes shut homolog is required for maintaining the ciliary pocket and survival of photoreceptors in zebrafish. Biol Open. 2016;5:1662-1673 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-90038
SKU :
NBP1-90038
product name :
EYS/RP25 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The EYS/RP25 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to EYS/RP25. This antibody reacts with human,fish - danio rerio (zebrafish). The EYS/RP25 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.
target :
EYS/RP25
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQF
VCLCPPLYTGQFCHQRYNLCDLLHNPCR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Fish - Danio rerio (Zebrafish)
gene symbol :
EYS
top caption :
EYS/RP25 Antibody - BSA Free Immunohistochemistry-Paraffin: EYS/RP25 Antibody - BSA Free [NBP1-90038]
applications :
IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
C6orf178, C6orf179, C6orf180, dJ22I17.2, dJ303F19.1, EGFL10, EGFL11, EGF-like-domain, multiple 10, EGF-like-domain, multiple 11, eyes shut homolog (Drosophila), protein spacemaker homolog
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.