EYS/RP25 Antibody - BSA Free | Novus Biologicals NBP1-90038 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

EYS/RP25 Antibody - BSA Free

catalog :

NBP1-90038

quantity :

0.1 ml (also 25 ul)

price :

529 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, zebrafish

application :

immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Sato K, Liu Y, Yamashita T, Ohuchi H. The medaka mutant deficient in eyes shut homolog exhibits opsin transport defects and enhanced autophagy in retinal photoreceptors. Cell Tissue Res. 2023;391:249-267 pubmed publisher
Liu Y, Rittershaus J, Yu M, Sager R, Hu H. Deletion of POMT2 in Zebrafish Causes Degeneration of Photoreceptors. Int J Mol Sci. 2022;23: pubmed publisher
Schellens R, de Vrieze E, Graave P, Broekman S, Nagel Wolfrum K, Peters T, et al. Zebrafish as a Model to Evaluate a CRISPR/Cas9-Based Exon Excision Approach as a Future Treatment Option for EYS-Associated Retinitis Pigmentosa. Int J Mol Sci. 2021;22: pubmed publisher
Kim J, Park J, Shin S, Lim B, Go H. Neo-Fs Index: A Novel Immunohistochemical Biomarker Panel Predicts Survival and Response to Anti-Angiogenetic Agents in Clear Cell Renal Cell Carcinoma. Cancers (Basel). 2021;13: pubmed publisher
Nishiguchi K, Miya F, Mori Y, Fujita K, Akiyama M, Kamatani T, et al. A hypomorphic variant in EYS detected by genome-wide association study contributes toward retinitis pigmentosa. Commun Biol. 2021;4:140 pubmed publisher
Liu Y, Cao S, Yu M, Hu H. TMEM216 Deletion Causes Mislocalization of Cone Opsin and Rhodopsin and Photoreceptor Degeneration in Zebrafish. Invest Ophthalmol Vis Sci. 2020;61:24 pubmed publisher
Liu Y, Yu M, Shang X, Nguyen M, Balakrishnan S, Sager R, et al. Eyes shut homolog (EYS) interacts with matriglycan of O-mannosyl glycans whose deficiency results in EYS mislocalization and degeneration of photoreceptors. Sci Rep. 2020;10:7795 pubmed publisher
Messchaert M, Dona M, Broekman S, Peters T, Corral Serrano J, Slijkerman R, et al. Eyes shut homolog is important for the maintenance of photoreceptor morphology and visual function in zebrafish. PLoS ONE. 2018;13:e0200789 pubmed publisher
Abbuehl J, Tatárová Z, Held W, Huelsken J. Long-Term Engraftment of Primary Bone Marrow Stromal Cells Repairs Niche Damage and Improves Hematopoietic Stem Cell Transplantation. Cell Stem Cell. 2017;21:241-255.e6 pubmed publisher
Lu Z, Hu X, Liu F, Soares D, Liu X, Yu S, et al. Ablation of EYS in zebrafish causes mislocalisation of outer segment proteins, F-actin disruption and cone-rod dystrophy. Sci Rep. 2017;7:46098 pubmed publisher
Yu M, Liu Y, Li J, Natale B, Cao S, Wang D, et al. Eyes shut homolog is required for maintaining the ciliary pocket and survival of photoreceptors in zebrafish. Biol Open. 2016;5:1662-1673 pubmed publisher

product information

master code :

NBP1-90038

SKU :

NBP1-90038

product name :

EYS/RP25 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The EYS/RP25 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to EYS/RP25. This antibody reacts with human,fish - danio rerio (zebrafish). The EYS/RP25 Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry-Frozen,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

EYS/RP25

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQF
VCLCPPLYTGQFCHQRYNLCDLLHNPCR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Fish - Danio rerio (Zebrafish)

gene symbol :

EYS

applications :

Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry-Frozen,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

529 USD

alt names :

C6orf178, C6orf179, C6orf180, dJ22I17.2, dJ303F19.1, EGFL10, EGFL11, EGF-like-domain, multiple 10, EGF-like-domain, multiple 11, eyes shut homolog (Drosophila), protein spacemaker homolog

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage