MMR/CD206/Mannose Receptor Antibody - BSA Free | Novus Biologicals NBP1-90020 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MMR/CD206/Mannose Receptor Antibody - BSA Free

catalog :

NBP1-90020

quantity :

0.1 ml (also 25 ul)

price :

469 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 15

Reference
Li X, Kempf S, Delgado Lagos F, Ukan x, Popp R, Hu J, et al. A regulatory loop involving the cytochrome P450-soluble epoxide hydrolase axis and TGF-β signaling. iScience. 2024;27:110938 pubmed publisher
Liu C, Zhou C, Xia W, Zhou Y, Qiu Y, Weng J, et al. Targeting ALK averts ribonuclease 1-induced immunosuppression and enhances antitumor immunity in hepatocellular carcinoma. Nat Commun. 2024;15:1009 pubmed publisher
McDonald S, Bullard B, VanderVeen B, Cardaci T, Chatzistamou I, Fan D, et al. Emodin reduces surgical wounding-accelerated tumor growth and metastasis via macrophage suppression in a murine triple-negative breast cancer model. Physiol Rep. 2023;11:e15813 pubmed publisher
Dravid A, Dhanabalan K, Naskar S, Vashistha A, Agarwal S, Padhan B, et al. Sustained release resolvin D1 liposomes are effective in the treatment of osteoarthritis in obese mice. J Biomed Mater Res A. 2023;111:765-777 pubmed publisher
Kim J, Kim G, Ryu Y, Kim S, Kim H, Yoon S, et al. Clinical implications of the tumor microenvironment using multiplexed immunohistochemistry in patients with advanced or metastatic renal cell carcinoma treated with nivolumab plus ipilimumab. Front Oncol. 2022;12:969569 pubmed publisher
Dravid A, M Dhanabalan K, Agarwal S, Agarwal R. Resolvin D1-loaded nanoliposomes promote M2 macrophage polarization and are effective in the treatment of osteoarthritis. Bioeng Transl Med. 2022;7:e10281 pubmed publisher
Xue L, Deng T, Guo R, Peng L, Guo J, Tang F, et al. A Composite Hydrogel Containing Mesoporous Silica Nanoparticles Loaded With Artemisia argyi Extract for Improving Chronic Wound Healing. Front Bioeng Biotechnol. 2022;10:825339 pubmed publisher
Kim H, Kim S, Kim J, Kim J, Hong Y, Han B, et al. Dynamic increase of M2 macrophages is associated with disease progression of colorectal cancers following cetuximab-based treatment. Sci Rep. 2022;12:1678 pubmed publisher
Lombardo K, Obradovic A, Singh A, Liu J, Joice G, Kates M, et al. BCG invokes superior STING-mediated innate immune response over radiotherapy in a carcinogen murine model of urothelial cancer. J Pathol. 2022;256:223-234 pubmed publisher
Roy R, Zayas J, Mohamed M, Aboonabi A, Delgado K, Wallace J, et al. IL-10 Dysregulation Underlies Chemokine Insufficiency, Delayed Macrophage Response, and Impaired Healing in Diabetic Wounds. J Invest Dermatol. 2022;142:692-704.e14 pubmed publisher
Mou K, Shen K, Li Y, Wu Z, Duan W. Adenosine A2A Receptor in Bone Marrow-Derived Cells Mediated Macrophages M2 Polarization via PPARγ-P65 Pathway in Chronic Hypoperfusion Situation. Front Aging Neurosci. 2021;13:792733 pubmed publisher
Saadati F, Moritz J, Berner J, Freund E, Miebach L, Helfrich I, et al. Patient-Derived Human Basal and Cutaneous Squamous Cell Carcinoma Tissues Display Apoptosis and Immunomodulation following Gas Plasma Exposure with a Certified Argon Jet. Int J Mol Sci. 2021;22: pubmed publisher
Davis T, Conradie D, Shridas P, de Beer F, Engelbrecht A, de Villiers W. Serum Amyloid A Promotes Inflammation-Associated Damage and Tumorigenesis in a Mouse Model of Colitis-Associated Cancer. Cell Mol Gastroenterol Hepatol. 2021;12:1329-1341 pubmed publisher
Sun G, Cao Y, Qian C, Wan Z, Zhu J, Guo J, et al. Romo1 is involved in the immune response of glioblastoma by regulating the function of macrophages. Aging (Albany NY). 2020;12:1114-1127 pubmed publisher
Siani F, Greco R, Levandis G, Ghezzi C, Daviddi F, DeMartini C, et al. Influence of Estrogen Modulation on Glia Activation in a Murine Model of Parkinson's Disease. Front Neurosci. 2017;11:306 pubmed publisher

product information

master code :

NBP1-90020

SKU :

NBP1-90020

product name :

MMR/CD206/Mannose Receptor Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The MMR/CD206/Mannose Receptor Antibody - BSA Free from Novus is a rabbit polyclonal antibody to MMR/CD206/Mannose Receptor. This antibody reacts with human,mouse,porcine,primate. The MMR/CD206/Mannose Receptor Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,Immunocytochemistry/ Immunofluorescence,Flow Cytometry,Western Blot.

target :

MMR/CD206/Mannose Receptor

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIM
SVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDT
LLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Porcine,Primate

gene symbol :

MRC1

Antibody validation :

Independent Anitbodies

applications :

Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,Immunocytochemistry/ Immunofluorescence,Flow Cytometry,Western Blot

USD :

469 USD

alt names :

CD206, CLEC13Dmacrophage mannose receptor 1, C-type lectin domain family 13 member D, mannose receptor, C type 1, MMRCD206 antigen

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage