Complement Factor B Antibody - BSA Free | Novus Biologicals NBP1-89985 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Complement Factor B Antibody - BSA Free

catalog :

NBP1-89985

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

M19B2

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Chen K, Deng Y, Shang S, Tang L, Li Q, Bai X, et al. Complement factor B inhibitor LNP023 improves lupus nephritis in MRL/lpr mice. Biomed Pharmacother. 2022;153:113433 pubmed publisher
Kendall R, Renaud L, Baatz J, Malaab M, Nguyen X, Feghali Bostwick C. Systemic sclerosis biomarkers detection in the secretome of TGFβ1-activated primary human lung fibroblasts. J Proteomics. 2021;242:104243 pubmed publisher
Mao Y, Liu X, Song Y, Zhai C, Xu X, Zhang L, et al. Fibroblast growth factor-2/platelet-derived growth factor enhances atherosclerotic plaque stability. J Cell Mol Med. 2020;24:1128-1140 pubmed publisher
Lin C, Titchenell P, Keil J, Garcia Ocana A, Bolinger M, ABCOUWER S, et al. Inhibition of Atypical Protein Kinase C Reduces Inflammation-Induced Retinal Vascular Permeability. Am J Pathol. 2018;188:2392-2405 pubmed publisher
Shih C, Chiang T, Wang W. Synergistic suppression of a disintegrin acurhagin-C in combination with AZD4547 and reparixin on terminating development for human osteosarcoma MG-63 cell. Biochem Biophys Res Commun. 2017;492:513-519 pubmed publisher
Schwenk B, Hartmann H, Serdaroglu A, Schludi M, Hornburg D, Meissner F, et al. TDP-43 loss of function inhibits endosomal trafficking and alters trophic signaling in neurons. EMBO J. 2016;35:2350-2370 pubmed
Yamanaka K, Kakuta Y, Miyagawa S, Nakazawa S, Kato T, Abe T, et al. Depression of Complement Regulatory Factors in Rat and Human Renal Grafts Is Associated with the Progress of Acute T-Cell Mediated Rejection. PLoS ONE. 2016;11:e0148881 pubmed publisher
Fu T, Seok S, Choi S, Huang Z, Suino Powell K, Xu H, et al. MicroRNA 34a inhibits beige and brown fat formation in obesity in part by suppressing adipocyte fibroblast growth factor 21 signaling and SIRT1 function. Mol Cell Biol. 2014;34:4130-42 pubmed publisher
Sasaki S, Ishida T, Toyota M, Ota A, Suzuki H, Takaoka A, et al. Interferon-?/? and anti-fibroblast growth factor receptor 1 monoclonal antibody suppress hepatic cancer cells in vitro and in vivo. PLoS ONE. 2011;6:e19618 pubmed publisher

product information

master code :

NBP1-89985

SKU :

NBP1-89985

product name :

Complement Factor B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Complement Factor B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Complement Factor B. This antibody reacts with human,mouse,rat. The Complement Factor B Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western.

target :

Complement Factor B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEH
RKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLT
AAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNIN
GKKEAGIPEFYDYDVALIKLKNKLKYG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

CFB

applications :

Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Simple Western

USD :

559 USD

alt names :

BF AHUS4, B-factor, properdin, BFD, C3 proaccelerator, C3 proactivator, C3/C5 convertase, complement factor B, EC 3.4.21, EC 3.4.21.47, FB, FBI12, GBGCFAB, Glycine-rich beta glycoprotein, glycine-rich beta-glycoprotein, H2-Bf, PBF2, Properdin factor B

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage