product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Dystrophin Antibody - BSA Free
catalog :
NBP1-89953
quantity :
0.1 ml (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
BV14
reactivity :
human, mouse
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 9
Reference
Mondello C, Ventura Spagnolo E, Bartoloni G, Alibrandi A, Cardia L, Sapienza D, et al. Dystrophin and metalloproteinase 9 in myocardial ischemia: A post-mortem immunohistochemical study. Leg Med (Tokyo). 2021;53:101948 pubmed publisher
Gao R, Kanasaki K, Li J, Kitada M, Okazaki T, Koya D. βklotho is essential for the anti-endothelial mesenchymal transition effects of N-acetyl-seryl-aspartyl-lysyl-proline. FEBS Open Bio. 2019;9:1029-1038 pubmed publisher
Mondello C, Cardia L, Bartoloni G, Asmundo A, Ventura Spagnolo E. Immunohistochemical study on dystrophin expression in CAD-related sudden cardiac death: a marker of early myocardial ischaemia. Int J Legal Med. 2018;132:1333-1339 pubmed publisher
Luo M, Flood E, Almeida D, Yan L, Berlin D, Heerdt P, et al. Annexin A2 supports pulmonary microvascular integrity by linking vascular endothelial cadherin and protein tyrosine phosphatases. J Exp Med. 2017;214:2535-2545 pubmed publisher
Kawase H, Bando Y, Nishimura K, Aoyama M, Monji A, Murohara T. A dipeptidyl peptidase-4 inhibitor ameliorates hypertensive cardiac remodeling via angiotensin-II/sodium-proton pump exchanger-1 axis. J Mol Cell Cardiol. 2016;98:37-47 pubmed publisher
Aoyama M, Kawase H, Bando Y, Monji A, Murohara T. Dipeptidyl Peptidase 4 Inhibition Alleviates Shortage of Circulating Glucagon-Like Peptide-1 in Heart Failure and Mitigates Myocardial Remodeling and Apoptosis via the Exchange Protein Directly Activated by Cyclic AMP 1/Ras-Related Protein 1 Axis. Circ Heart Fail. 2016;9:e002081 pubmed publisher
Crosby C, Fleming P, Argraves W, Corada M, Zanetta L, Dejana E, et al. VE-cadherin is not required for the formation of nascent blood vessels but acts to prevent their disassembly. Blood. 2005;105:2771-6 pubmed
Liao F, Li Y, O Connor W, Zanetta L, Bassi R, Santiago A, et al. Monoclonal antibody to vascular endothelial-cadherin is a potent inhibitor of angiogenesis, tumor growth, and metastasis. Cancer Res. 2000;60:6805-10 pubmed
Corada M, Mariotti M, Thurston G, Smith K, Kunkel R, Brockhaus M, et al. Vascular endothelial-cadherin is an important determinant of microvascular integrity in vivo. Proc Natl Acad Sci U S A. 1999;96:9815-20 pubmed
product information
brand :
Novus
catalog number base :
NBP1-89953
SKU :
NBP1-89953
product name :
Dystrophin Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Dystrophin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Dystrophin. This antibody reacts with human,mouse. The Dystrophin Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Dystrophin
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGL
EKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNL
HSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGS
WQPVGDLLIDSLQDHLEKVKALRGEIAPLKENV
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
DMD
Antibody validation :
Orthogonal Validation
top caption :
Dystrophin Antibody - BSA Free Immunohistochemistry-Paraffin: Dystrophin Antibody - BSA Free [NBP1-89953]
applications :
IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
BMDDXS272, CMD3B, DXS142, DXS164, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, dystrophin, dystrophin (muscular dystrophy, Duchenne and Becker types), includes DXS142
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.