This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CLC Antibody
catalog :
NBP1-89926
quantity :
0.1 ml (also 25 ul)
price :
519 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
OTI6E3
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne Brand
catalog number base :
NBP1-89926
SKU :
NBP1-89926
product name :
CLC Antibody
Description :
The CLC Antibody from Novus is a rabbit polyclonal antibody to CLC. This antibody reacts with human. The CLC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin.
target :
CLC
category :
Primary Antibodies
unit size :
0.1 ml (also 25 ul)
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLG
AETLPRATVDLEVWRSLNDKLRLTQNYE
This antibody was developed against Recombinant Protein corresponding to amino acids:
AETLPRATVDLEVWRSLNDKLRLTQNYE
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
CLCF1
applications :
Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
USD :
519 USD
alt names :
B-cell stimulating factor 3, B-cell stimulatory factor 3, BSF3BSF-3, cardiotrophin-like cytokine factor 1, CISS2, CLCNNT-1, CRLF1 associated cytokine-like factor 1, neurotrophin-1/B-cell stimulating factor-3, NNT1B-cell-stimulating factor 3, Novel neurotrophin-1, NR6
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
