Glutaminase Antibody - BSA Free | Novus Biologicals NBP1-89766 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Glutaminase Antibody - BSA Free

catalog :

NBP1-89766

quantity :

0.1 ml

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Benichou E, Seffou B, Top xe7 u S, Renoult O, Lenoir V, Planchais J, et al. The transcription factor ChREBP Orchestrates liver carcinogenesis by coordinating the PI3K/AKT signaling and cancer metabolism. Nat Commun. 2024;15:1879 pubmed publisher
Briski K, Napit P, Alhamyani A, Leprince J, Mahmood A. Sex-Dimorphic Octadecaneuropeptide (ODN) Regulation of Ventromedial Hypothalamic Nucleus Glucoregulatory Neuron Function and Counterregulatory Hormone Secretion. ASN Neuro. 2023;15:17590914231167230 pubmed publisher
Uddin M, Ibrahim M, Briski K. Sex-dimorphic neuroestradiol regulation of ventromedial hypothalamic nucleus glucoregulatory transmitter and glycogen metabolism enzyme protein expression in the rat. BMC Neurosci. 2020;21:51 pubmed publisher
Huang P, Peslak S, Lan X, Khandros E, Yano J, Sharma M, et al. The HRI-regulated transcription factor ATF4 activates BCL11A transcription to silence fetal hemoglobin expression. Blood. 2020;135:2121-2132 pubmed publisher
Khandros E, Huang P, Peslak S, Sharma M, Abdulmalik O, Giardine B, et al. Understanding heterogeneity of fetal hemoglobin induction through comparative analysis of F and A erythroblasts. Blood. 2020;135:1957-1968 pubmed publisher
Makino T, Haruyama M, Katayama K, Terashima H, Tsunemi T, Miyazaki K, et al. Phenotypic-screening generates active novel fetal globin-inducers that downregulate Bcl11a in a monkey model. Biochem Pharmacol. 2020;171:113717 pubmed publisher
Uddin M, Mahmood A, Ibrahim M, Briski K. Sex-dimorphic estrogen receptor regulation of ventromedial hypothalamic nucleus glucoregulatory neuron adrenergic receptor expression in hypoglycemic male and female rats. Brain Res. 2019;1720:146311 pubmed publisher
Tanaka K, Sasayama T, Irino Y, Takata K, Nagashima H, Satoh N, et al. Compensatory glutamine metabolism promotes glioblastoma resistance to mTOR inhibitor treatment. J Clin Invest. 2015;125:1591-602 pubmed publisher

product information

master code :

NBP1-89766

SKU :

NBP1-89766

product name :

Glutaminase Antibody - BSA Free

unit size :

0.1 ml

description :

The Glutaminase Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Glutaminase. This antibody reacts with human,mouse,rat. The Glutaminase Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Glutaminase

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNG
KENQTVHKNLDGL
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

GLS

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

549 USD

alt names :

AAD20, EC 3.5.1.2, GLS1DKFZp686O15119, glutaminase, glutaminase C, glutaminase kidney isoform, mitochondrial, glutaminase, phosphate-activated, K-glutaminase, KIAA0838FLJ10358, L-glutamine amidohydrolase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage