product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Glutaminase Antibody - BSA Free
catalog :
NBP1-89766
quantity :
0.1 ml
price :
549 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 8
Reference
Benichou E, Seffou B, Top xe7 u S, Renoult O, Lenoir V, Planchais J, et al. The transcription factor ChREBP Orchestrates liver carcinogenesis by coordinating the PI3K/AKT signaling and cancer metabolism. Nat Commun. 2024;15:1879 pubmed publisher
Briski K, Napit P, Alhamyani A, Leprince J, Mahmood A. Sex-Dimorphic Octadecaneuropeptide (ODN) Regulation of Ventromedial Hypothalamic Nucleus Glucoregulatory Neuron Function and Counterregulatory Hormone Secretion. ASN Neuro. 2023;15:17590914231167230 pubmed publisher
Uddin M, Ibrahim M, Briski K. Sex-dimorphic neuroestradiol regulation of ventromedial hypothalamic nucleus glucoregulatory transmitter and glycogen metabolism enzyme protein expression in the rat. BMC Neurosci. 2020;21:51 pubmed publisher
Huang P, Peslak S, Lan X, Khandros E, Yano J, Sharma M, et al. The HRI-regulated transcription factor ATF4 activates BCL11A transcription to silence fetal hemoglobin expression. Blood. 2020;135:2121-2132 pubmed publisher
Khandros E, Huang P, Peslak S, Sharma M, Abdulmalik O, Giardine B, et al. Understanding heterogeneity of fetal hemoglobin induction through comparative analysis of F and A erythroblasts. Blood. 2020;135:1957-1968 pubmed publisher
Makino T, Haruyama M, Katayama K, Terashima H, Tsunemi T, Miyazaki K, et al. Phenotypic-screening generates active novel fetal globin-inducers that downregulate Bcl11a in a monkey model. Biochem Pharmacol. 2020;171:113717 pubmed publisher
Uddin M, Mahmood A, Ibrahim M, Briski K. Sex-dimorphic estrogen receptor regulation of ventromedial hypothalamic nucleus glucoregulatory neuron adrenergic receptor expression in hypoglycemic male and female rats. Brain Res. 2019;1720:146311 pubmed publisher
Tanaka K, Sasayama T, Irino Y, Takata K, Nagashima H, Satoh N, et al. Compensatory glutamine metabolism promotes glioblastoma resistance to mTOR inhibitor treatment. J Clin Invest. 2015;125:1591-602 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-89766
SKU :
NBP1-89766
product name :
Glutaminase Antibody - BSA Free
units size :
0.1 ml
description :
The Glutaminase Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Glutaminase. This antibody reacts with human,mouse,rat. The Glutaminase Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Glutaminase
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNG
KENQTVHKNLDGL
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
GLS
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766]
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
549 USD
alt names :
AAD20, EC 3.5.1.2, GLS1DKFZp686O15119, glutaminase, glutaminase C, glutaminase kidney isoform, mitochondrial, glutaminase, phosphate-activated, K-glutaminase, KIAA0838FLJ10358, L-glutamine amidohydrolase
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.