TCF-2/HNF-1 beta Antibody - BSA Free | Novus Biologicals NBP1-89680 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TCF-2/HNF-1 beta Antibody - BSA Free

catalog :

NBP1-89680

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Holokai L, Chakrabarti J, Lundy J, Croagh D, Adhikary P, Richards S, et al. Murine- and Human-Derived Autologous Organoid/Immune Cell Co-Cultures as Pre-Clinical Models of Pancreatic Ductal Adenocarcinoma. Cancers (Basel). 2020;12: pubmed publisher
Zhang F, Liu Y, Wang D, Liu T, Yang Y, Guo J, et al. Obesity-induced reduced expression of the lncRNA ROIT impairs insulin transcription by downregulation of Nkx6.1 methylation. Diabetologia. 2020;63:811-824 pubmed publisher
Zhao T, Goedhart C, Sam P, Sabouny R, Lingrell S, Cornish A, et al. PISD is a mitochondrial disease gene causing skeletal dysplasia, cataracts, and white matter changes. Life Sci Alliance. 2019;2: pubmed publisher
Yang Y, Qin M, Bao P, Xu W, Xu J. Secretory carrier membrane protein 5 is an autophagy inhibitor that promotes the secretion of ?-synuclein via exosome. PLoS ONE. 2017;12:e0180892 pubmed publisher
Gorur A, Yuan L, Kenny S, Baba S, Xu K, Schekman R. COPII-coated membranes function as transport carriers of intracellular procollagen I. J Cell Biol. 2017;216:1745-1759 pubmed publisher
Morii M, Kubota S, Honda T, Yuki R, Morinaga T, Kuga T, et al. Src Acts as an Effector for Ku70-dependent Suppression of Apoptosis through Phosphorylation of Ku70 at Tyr-530. J Biol Chem. 2017;292:1648-1665 pubmed publisher
Yokoi S, Ishihara N, Miya F, Tsutsumi M, Yanagihara I, Fujita N, et al. TUBA1A mutation can cause a hydranencephaly-like severe form of cortical dysgenesis. Sci Rep. 2015;5:15165 pubmed publisher
Goyeneche A, Koch M, Bell M, Telleria C. Long-term primary culture of a clear cell ovarian carcinoma reveals an epithelial-mesenchymal cooperative interaction. Cancer Cell Int. 2015;15:88 pubmed publisher
Semaan M, Ivanusic D, Denner J. Cytotoxic Effects during Knock Out of Multiple Porcine Endogenous Retrovirus (PERV) Sequences in the Pig Genome by Zinc Finger Nucleases (ZFN). PLoS ONE. 2015;10:e0122059 pubmed publisher

product information

master code :

NBP1-89680

SKU :

NBP1-89680

product name :

TCF-2/HNF-1 beta Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The TCF-2/HNF-1 beta Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TCF-2/HNF-1 beta. This antibody reacts with human,mouse. The TCF-2/HNF-1 beta Antibody - BSA Free has been validated for the following applications: Chemotaxis,IF/IHC,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Chromatin Immunoprecipitation (ChIP).

target :

TCF-2/HNF-1 beta

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPV
FHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNT
EEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

HNF1B

Antibody validation :

Orthogonal Validation

accessionNumbers :

P35680

applications :

Chemotaxis,IF/IHC,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Chromatin Immunoprecipitation (ChIP)

USD :

549 USD

alt names :

FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage