product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TCF-2/HNF-1 beta Antibody - BSA Free
catalog :
NBP1-89680
quantity :
0.1 ml (also 25 ul)
price :
549 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 9
Reference
Holokai L, Chakrabarti J, Lundy J, Croagh D, Adhikary P, Richards S, et al. Murine- and Human-Derived Autologous Organoid/Immune Cell Co-Cultures as Pre-Clinical Models of Pancreatic Ductal Adenocarcinoma. Cancers (Basel). 2020;12: pubmed publisher
Zhang F, Liu Y, Wang D, Liu T, Yang Y, Guo J, et al. Obesity-induced reduced expression of the lncRNA ROIT impairs insulin transcription by downregulation of Nkx6.1 methylation. Diabetologia. 2020;63:811-824 pubmed publisher
Zhao T, Goedhart C, Sam P, Sabouny R, Lingrell S, Cornish A, et al. PISD is a mitochondrial disease gene causing skeletal dysplasia, cataracts, and white matter changes. Life Sci Alliance. 2019;2: pubmed publisher
Yang Y, Qin M, Bao P, Xu W, Xu J. Secretory carrier membrane protein 5 is an autophagy inhibitor that promotes the secretion of ?-synuclein via exosome. PLoS ONE. 2017;12:e0180892 pubmed publisher
Gorur A, Yuan L, Kenny S, Baba S, Xu K, Schekman R. COPII-coated membranes function as transport carriers of intracellular procollagen I. J Cell Biol. 2017;216:1745-1759 pubmed publisher
Morii M, Kubota S, Honda T, Yuki R, Morinaga T, Kuga T, et al. Src Acts as an Effector for Ku70-dependent Suppression of Apoptosis through Phosphorylation of Ku70 at Tyr-530. J Biol Chem. 2017;292:1648-1665 pubmed publisher
Yokoi S, Ishihara N, Miya F, Tsutsumi M, Yanagihara I, Fujita N, et al. TUBA1A mutation can cause a hydranencephaly-like severe form of cortical dysgenesis. Sci Rep. 2015;5:15165 pubmed publisher
Goyeneche A, Koch M, Bell M, Telleria C. Long-term primary culture of a clear cell ovarian carcinoma reveals an epithelial-mesenchymal cooperative interaction. Cancer Cell Int. 2015;15:88 pubmed publisher
Semaan M, Ivanusic D, Denner J. Cytotoxic Effects during Knock Out of Multiple Porcine Endogenous Retrovirus (PERV) Sequences in the Pig Genome by Zinc Finger Nucleases (ZFN). PLoS ONE. 2015;10:e0122059 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-89680
SKU :
NBP1-89680
product name :
TCF-2/HNF-1 beta Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The TCF-2/HNF-1 beta Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TCF-2/HNF-1 beta. This antibody reacts with human,mouse. The TCF-2/HNF-1 beta Antibody - BSA Free has been validated for the following applications: Chemotaxis,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence.
target :
TCF-2/HNF-1 beta
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPV
FHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNT
EEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
HNF1B
review stars :
5
Antibody validation :
Orthogonal Validation
top caption :
TCF-2/HNF-1 beta Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: TCF-2/HNF-1 beta Antibody - BSA Free [NBP1-89680]
accessionNumbers :
P35680
applications :
Chemotaxis,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence
USD :
549 USD
alt names :
FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.