HNF-4 alpha/NR2A1 Antibody - BSA Free | Novus Biologicals NBP1-89679 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

HNF-4 alpha/NR2A1 Antibody - BSA Free

catalog :

NBP1-89679

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Engelmann C, Adebayo D, Oria M, De Chiara F, Novelli S, Habtesion A, et al. Recombinant Alkaline Phosphatase Prevents Acute on Chronic Liver Failure. Sci Rep. 2020;10:389 pubmed publisher
Long Y, Tao H, Karachi A, Grippin A, Jin L, Chang Y, et al. Dysregulation of Glutamate Transport Enhances Treg Function That Promotes VEGF Blockade Resistance in Glioblastoma. Cancer Res. 2020;80:499-509 pubmed publisher
Huang M, Lin Y, Chang C, Lei F, Ho E, Liu R, et al. RGS4 deficit in prefrontal cortex contributes to the behaviors related to schizophrenia via system xc--mediated glutamatergic dysfunction in mice. Theranostics. 2018;8:4781-4794 pubmed publisher
Zhang W, Zhong W, Sun Q, Sun X, Zhou Z. Hepatic overproduction of 13-HODE due to ALOX15 upregulation contributes to alcohol-induced liver injury in mice. Sci Rep. 2017;7:8976 pubmed publisher
Chew S, Okazaki Y, Akatsuka S, Wang S, Jiang L, Ohara Y, et al. Rheostatic CD44 isoform expression and its association with oxidative stress in human malignant mesothelioma. Free Radic Biol Med. 2017;106:91-99 pubmed publisher
Zhong W, Li Q, Sun Q, Zhang W, Zhang J, Sun X, et al. Preventing Gut Leakiness and Endotoxemia Contributes to the Protective Effect of Zinc on Alcohol-Induced Steatohepatitis in Rats. J Nutr. 2015;145:2690-8 pubmed publisher
Linher Melville K, Haftchenary S, Gunning P, Singh G. Signal transducer and activator of transcription 3 and 5 regulate system Xc- and redox balance in human breast cancer cells. Mol Cell Biochem. 2015;405:205-21 pubmed publisher
Bonner C, Kerr Conte J, Gmyr V, Queniat G, Moerman E, ThÃ©venet J, et al. Inhibition of the glucose transporter SGLT2 with dapagliflozin in pancreatic alpha cells triggers glucagon secretion. Nat Med. 2015;21:512-7 pubmed publisher

product information

master code :

NBP1-89679

SKU :

NBP1-89679

product name :

HNF-4 alpha/NR2A1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The HNF-4 alpha/NR2A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to HNF-4 alpha/NR2A1. This antibody reacts with human,mouse,rat. The HNF-4 alpha/NR2A1 Antibody - BSA Free has been validated for the following applications: Chromatin Immunoprecipitation-exo-Seq,IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.

target :

HNF-4 alpha/NR2A1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANT
MPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPY
KLLPGAVATIVKPLSAIPQPTITKQEV
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

HNF4A

Antibody validation :

Orthogonal Validation

accessionNumbers :

P41235

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen

USD :

569 USD

alt names :

FLJ39654, hepatic nuclear factor 4 alpha, hepatocyte nuclear factor 4, alpha, hepatocyte nuclear factor 4-alpha, HNF4a7, HNF-4-alpha, HNF4alpha10/11/12, HNF4HNF4a8, MODY, MODY1, NR2A1HNF4a9, NR2A21, Nuclear receptor subfamily 2 group A member 1, TCF, TCF-14, TCF14HNF4alpha, Transcription factor 14, Transcription factor HNF-4, transcription factor-14

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage