VAP-1/AOC3 Antibody - BSA Free | Novus Biologicals NBP1-89671 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

VAP-1/AOC3 Antibody - BSA Free

catalog :

NBP1-89671

quantity :

0.1 ml

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

111F8.04

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Kuipers M, Nolte t Hoen E, van der Ham A, Ozir Fazalalikhan A, Nguyen D, de Korne C, et al. DC-SIGN mediated internalisation of glycosylated extracellular vesicles from Schistosoma mansoni increases activation of monocyte-derived dendritic cells. J Extracell Vesicles. 2020;9:1753420 pubmed publisher
Clark G, Kupresanin F, Fromm P, Ju X, Muusers L, Silveira P, et al. New insights into the phenotype of human dendritic cell populations. Clin Transl Immunology. 2016;5:e61 pubmed publisher
Ohradanova Repic A, Machacek C, Fischer M, Stockinger H. Differentiation of human monocytes and derived subsets of macrophages and dendritic cells by the HLDA10 monoclonal antibody panel. Clin Transl Immunology. 2016;5:e55 pubmed publisher
Autenrieth S, Grimm S, Rittig S, Grunebach F, Gouttefangeas C, Buhring H. Profiling of primary peripheral blood- and monocyte-derived dendritic cells using monoclonal antibodies from the HLDA10 Workshop in Wollongong, Australia. Clin Transl Immunology. 2015;4:e50 pubmed publisher
GarcÃa Vallejo J, Bloem K, Knippels L, Garssen J, van Vliet S, van Kooyk Y. The Consequences of Multiple Simultaneous C-Type Lectin-Ligand Interactions: DCIR Alters the Endo-Lysosomal Routing of DC-SIGN. Front Immunol. 2015;6:87 pubmed publisher
Weston C, Shepherd E, Claridge L, Rantakari P, Curbishley S, Tomlinson J, et al. Vascular adhesion protein-1 promotes liver inflammation and drives hepatic fibrosis. J Clin Invest. 2015;125:501-20 pubmed publisher
Tel J, Sittig S, Blom R, Cruz L, Schreibelt G, Figdor C, et al. Targeting uptake receptors on human plasmacytoid dendritic cells triggers antigen cross-presentation and robust type I IFN secretion. J Immunol. 2013;191:5005-12 pubmed publisher
Bloem K, Vuist I, van der Plas A, Knippels L, Garssen J, Garcia Vallejo J, et al. Ligand binding and signaling of dendritic cell immunoreceptor (DCIR) is modulated by the glycosylation of the carbohydrate recognition domain. PLoS ONE. 2013;8:e66266 pubmed publisher
Bloem K, Garcia Vallejo J, Vuist I, Cobb B, van Vliet S, van Kooyk Y. Interaction of the Capsular Polysaccharide A from Bacteroides fragilis with DC-SIGN on Human Dendritic Cells is Necessary for Its Processing and Presentation to T Cells. Front Immunol. 2013;4:103 pubmed publisher
Tjomsland V, Spångeus A, Sandstrom P, Borch K, Messmer D, Larsson M. Semi mature blood dendritic cells exist in patients with ductal pancreatic adenocarcinoma owing to inflammatory factors released from the tumor. PLoS ONE. 2010;5:e13441 pubmed publisher
Bates E, Fournier N, Garcia E, Valladeau J, Durand I, Pin J, et al. APCs express DCIR, a novel C-type lectin surface receptor containing an immunoreceptor tyrosine-based inhibitory motif. J Immunol. 1999;163:1973-83 pubmed

product information

master code :

NBP1-89671

SKU :

NBP1-89671

product name :

VAP-1/AOC3 Antibody - BSA Free

unit size :

0.1 ml

description :

The VAP-1/AOC3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to VAP-1/AOC3. This antibody reacts with equine,human. The VAP-1/AOC3 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.

target :

VAP-1/AOC3

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPR
GLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALD
PARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Equine,Human

gene symbol :

AOC3

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin

USD :

549 USD

alt names :

amine oxidase, copper containing 3 (vascular adhesion protein 1), Copper amine oxidase, EC 1.4.3, HPAOSSAO, Semicarbazide-sensitive amine oxidase, VAP1EC 1.4.3.21, VAP-1membrane primary amine oxidase, Vascular adhesion protein 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage