Neogenin Antibody - BSA Free | Novus Biologicals NBP1-89651 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Neogenin Antibody - BSA Free

catalog :

NBP1-89651

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Park J, Kim Y, Lee S, Ko J, Kim D, Lee J. Down-Regulation of Neogenin Decreases Proliferation and Differentiation of Spermatogonia during the Early Phase of Spermatogenesis. Int J Mol Sci. 2022;23: pubmed publisher
Untiveros G, Raskind A, Linares L, Dotti A, Strizzi L. Netrin-1 Stimulates Migration of Neogenin Expressing Aggressive Melanoma Cells. Int J Mol Sci. 2022;23: pubmed publisher
Yuan X, Xiao H, Hu Q, Shen G, Qin X. RGMa promotes dedifferentiation of vascular smooth muscle cells into a macrophage-like phenotype in vivo and in vitro. J Lipid Res. 2022;63:100276 pubmed publisher
Jiang R, Zheng X, Yang S, Shi H, Xi J, Zou Y, et al. CD146 mediates the anti-apoptotic role of Netrin-1 in endothelial progenitor cells under hypoxic conditions. Mol Med Rep. 2022;25: pubmed publisher
Abdullah A, Herdenberg C, Hedman H. Netrin-1 functions as a suppressor of bone morphogenetic protein (BMP) signaling. Sci Rep. 2021;11:8585 pubmed publisher
Kim Y, Park Y, Park Y, Kim Y, Lee H, Lee S, et al. Role of RGMc as a Neogenin Ligand in Follicular Development in the Ovary. Biomedicines. 2021;9: pubmed publisher
Tanabe S, Fujita Y, Ikuma K, Yamashita T. Inhibiting repulsive guidance molecule-a suppresses secondary progression in mouse models of multiple sclerosis. Cell Death Dis. 2018;9:1061 pubmed publisher

product information

master code :

NBP1-89651

SKU :

NBP1-89651

product name :

Neogenin Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Neogenin Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Neogenin. This antibody reacts with human,mouse,rat. The Neogenin Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,IF/IHC,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.

target :

Neogenin

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPN
PIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESE
DSMSTLAGR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

NEO1

Antibody validation :

Orthogonal Validation

applications :

Western Blot,IF/IHC,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

559 USD

alt names :

HsT17534, IGDCC2DKFZp547B146, Immunoglobulin superfamily DCC subclass member 2, neogenin, neogenin (chicken) homolog 1, neogenin 1, neogenin homolog 1, NGNDKFZp547A066

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage