TOP2B Antibody - BSA Free | Novus Biologicals NBP1-89527 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TOP2B Antibody - BSA Free

catalog :

NBP1-89527

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

3G3

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Wang T, Kyle A, Baker J, Liu N, Ban xe1 th J, Minchinton A. DNA-PK inhibition extends the therapeutic effects of Top2 poisoning to non-proliferating cells, increasing activity at a cost. Sci Rep. 2023;13:12429 pubmed publisher
Lee S, Jun Y, Linares G, Butler B, Yuva Adyemir Y, Moore J, et al. Downregulation of Hsp90 and the antimicrobial peptide Mtk suppresses poly(GR)-induced neurotoxicity in C9ORF72-ALS/FTD. Neuron. 2023;111:1381-1390.e6 pubmed publisher
Siddaway R, Milos S, Coyaud x, Yun H, Morcos S, Pajovic S, et al. The in vivo Interaction Landscape of Histones H3.1 and H3.3. Mol Cell Proteomics. 2022;21:100411 pubmed publisher
Hu H, Shiflett L, Kobayashi M, Chao M, Wilson A, Mohr I, et al. TOP2β-Dependent Nuclear DNA Damage Shapes Extracellular Growth Factor Responses via Dynamic AKT Phosphorylation to Control Virus Latency. Mol Cell. 2019;74:466-480.e4 pubmed publisher
Ali A, Biswas A, Pal M. HSF1 mediated TNF-α production during proteotoxic stress response pioneers proinflammatory signal in human cells. FASEB J. 2018;:fj201801482R pubmed publisher
Aviner R, Shenoy A, Elroy Stein O, Geiger T. Uncovering Hidden Layers of Cell Cycle Regulation through Integrative Multi-omic Analysis. PLoS Genet. 2015;11:e1005554 pubmed publisher
Gavin M, Torgerson T, Houston E, deRoos P, Ho W, Stray Pedersen A, et al. Single-cell analysis of normal and FOXP3-mutant human T cells: FOXP3 expression without regulatory T cell development. Proc Natl Acad Sci U S A. 2006;103:6659-64 pubmed

product information

master code :

NBP1-89527

SKU :

NBP1-89527

product name :

TOP2B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The TOP2B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TOP2B. This antibody reacts with human,insect - drosophila,mouse,rat. The TOP2B Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

TOP2B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGK
PKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKK
KGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKG
PKPKREKKEPGTRVRKTPTSSGKPSA
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Insect - Drosophila,Mouse,Rat

gene symbol :

TOP2B

Antibody validation :

Knockout/Knockdown

applications :

Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

antigen MLAA-44, DNA topoisomerase 2-beta, DNA topoisomerase II beta, DNA topoisomerase II, 180 kD, DNA topoisomerase II, beta isozyme, EC 5.99.1.3, top2beta, TOPIIB, topo II beta, topoisomerase (DNA) II beta (180kD), topoisomerase (DNA) II beta 180kDa, topoisomerase II beta, topoisomerase IIb, U937 associated antigen

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage