S100A6 Antibody - BSA Free | Novus Biologicals NBP1-89388 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

S100A6 Antibody - BSA Free

catalog :

NBP1-89388

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

DH8.3

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Schartz N, Liang H, Carvalho K, Chu S, Mendoza Arvilla A, Petrisko T, et al. C5aR1 antagonism suppresses inflammatory glial gene expression and alters cellular signaling in an aggressive Alzheimer's model. bioRxiv. 2023;: pubmed publisher
DERK J, Como C, Jones H, Joyce L, Kim S, Spencer B, et al. Formation and function of the meningeal arachnoid barrier around the developing mouse brain. Dev Cell. 2023;58:635-644.e4 pubmed publisher
Jones H, Abrams K, Siegenthaler J. Techniques for visualizing fibroblast-vessel interactions in the developing and adult CNS. Neurophotonics. 2022;9:021911 pubmed publisher
Driskill J, Zheng Y, Wu B, Wang L, Cai J, Rakheja D, et al. WWTR1(TAZ)-CAMTA1 reprograms endothelial cells to drive epithelioid hemangioendothelioma. Genes Dev. 2021;35:495-511 pubmed publisher
DeSisto J, O Rourke R, Jones H, Pawlikowski B, Malek A, Bonney S, et al. Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function. Dev Cell. 2020;54:43-59.e4 pubmed publisher
Plichta Z, Horak D, Marekova D, Turnovcova K, Kaiser R, Jendelova P. Poly[N-(2-hydroxypropyl)methacrylamide]-Modified Magnetic γ-F2 O3 Nanoparticles Conjugated with Doxorubicin for Glioblastoma Treatment. ChemMedChem. 2020;15:96-104 pubmed publisher
Tian Z, Wang C, Wang T, Li Y, Wang Z. Glial S100A6 Degrades β-amyloid Aggregation through Targeting Competition with Zinc Ions. Aging Dis. 2019;10:756-769 pubmed publisher
Damaghi M, Tafreshi N, Lloyd M, Sprung R, Estrella V, Wojtkowiak J, et al. Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane. Nat Commun. 2015;6:8752 pubmed publisher
Nishikawa R, Sugiyama T, Narita Y, Furnari F, Cavenee W, Matsutani M. Immunohistochemical analysis of the mutant epidermal growth factor, deltaEGFR, in glioblastoma. Brain Tumor Pathol. 2004;21:53-6 pubmed
Jungbluth A, Stockert E, Huang H, Collins V, Coplan K, Iversen K, et al. A monoclonal antibody recognizing human cancers with amplification/overexpression of the human epidermal growth factor receptor. Proc Natl Acad Sci U S A. 2003;100:639-44 pubmed
Johns T, Stockert E, Ritter G, Jungbluth A, Huang H, Cavenee W, et al. Novel monoclonal antibody specific for the de2-7 epidermal growth factor receptor (EGFR) that also recognizes the EGFR expressed in cells containing amplification of the EGFR gene. Int J Cancer. 2002;98:398-408 pubmed

product information

master code :

NBP1-89388

SKU :

NBP1-89388

product name :

S100A6 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The S100A6 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to S100A6. This antibody reacts with human,mouse,rat. The S100A6 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin.

target :

S100A6

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAE
IARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

S100A6

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

2A9, CABP, CACY5B10, calcyclin, Growth factor-inducible protein 2A9, MLN 4, PRAS100 calcium binding protein A6 (calcyclin), Prolactin receptor-associated protein, protein S100-A6, S100 calcium binding protein A6, S100 calcium-binding protein A6, S100 calcium-binding protein A6 (calcyclin)

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage