product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ATP6V0A1 Antibody - BSA Free
catalog :
NBP1-89342
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
1D7
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 32
Reference
Pepe S, Aprile D, Castroflorio E, Marte A, Giubbolini S, Hopestone S, et al. TBC1D24 interacts with the v-ATPase and regulates intraorganellar pH in neurons. iScience. 2025;28:111515 pubmed publisher
Esposito A, Pepe S, Cerullo M, Cortese K, Semini H, Gioved xec S, et al. ATP6V1A is required for synaptic rearrangements and plasticity in murine hippocampal neurons. Acta Physiol (Oxf). 2024;240:e14186 pubmed publisher
Solopova E, Romero Fernandez W, Harmsen H, Ventura Antunes L, Wang E, Shostak A, et al. Fatal iatrogenic cerebral β-amyloid-related arteritis in a woman treated with lecanemab for Alzheimer's disease. Nat Commun. 2023;14:8220 pubmed publisher
Mori H, Peterson S, Simmermon R, Overmyer K, Nishii A, Paulsson E, et al. SCD1 and monounsaturated lipids are required for autophagy and survival of adipocytes. bioRxiv. 2023;: pubmed publisher
Kanematsu A. Editorial Comment to "Does primary urethral realignment improve the outcome of pediatric pelvic fracture urethral injury? A randomized controlled trial". Int J Urol. 2023;30:929-930 pubmed publisher
Burrinha T, Cunha C, Hall M, Lopes da Silva M, Seabra M, Guimas Almeida C. Deacidification of endolysosomes by neuronal aging drives synapse loss. Traffic. 2023;24:334-354 pubmed publisher
Hoch L, Bourg N, Degrugillier F, Bruge C, Benabides M, Pellier E, et al. Dual Blockade of Misfolded Alpha-Sarcoglycan Degradation by Bortezomib and Givinostat Combination. Front Pharmacol. 2022;13:856804 pubmed publisher
Choezom D, Gross J. Neutral sphingomyelinase 2 controls exosome secretion by counteracting V-ATPase-mediated endosome acidification. J Cell Sci. 2022;135: pubmed publisher
Yamazaki Y, Eura Y, Kokame K. V-ATPase V0a1 promotes Weibel-Palade body biogenesis through the regulation of membrane fission. elife. 2021;10: pubmed publisher
Volcic M, Sparrer K, Koepke L, Hotter D, Sauter D, Stürzel C, et al. Vpu modulates DNA repair to suppress innate sensing and hyper-integration of HIV-1. Nat Microbiol. 2020;5:1247-1261 pubmed publisher
Fagan Solis K, Simpson D, Kumar R, Martelotto L, Mose L, Rashid N, et al. A P53-Independent DNA Damage Response Suppresses Oncogenic Proliferation and Genome Instability. Cell Rep. 2020;30:1385-1399.e7 pubmed publisher
McGuire C, Collins M, Sun Wada G, Wada Y, Forgac M. Isoform-specific gene disruptions reveal a role for the V-ATPase subunit a4 isoform in the invasiveness of 4T1-12B breast cancer cells. J Biol Chem. 2019;: pubmed publisher
Senturk M, Lin G, Zuo Z, Mao D, Watson E, Mikos A, et al. Ubiquilins regulate autophagic flux through mTOR signalling and lysosomal acidification. Nat Cell Biol. 2019;21:384-396 pubmed publisher
Li C, Mahon C, Sweeney N, Verschueren E, Kantamani V, Li D, et al. PPARγ Interaction with UBR5/ATMIN Promotes DNA Repair to Maintain Endothelial Homeostasis. Cell Rep. 2019;26:1333-1343.e7 pubmed publisher
Bagh M, Peng S, Chandra G, Zhang Z, Singh S, Pattabiraman N, et al. Misrouting of v-ATPase subunit V0a1 dysregulates lysosomal acidification in a neurodegenerative lysosomal storage disease model. Nat Commun. 2017;8:14612 pubmed publisher
Choi S, Hong H, Cho Y, Lee W, Yoo H. Identification of Sestrin3 Involved in the In vitro Resistance of Colorectal Cancer Cells to Irinotecan. PLoS ONE. 2015;10:e0126830 pubmed publisher
Moudry P, Lukas C, Macurek L, Neumann B, Hériché J, Pepperkok R, et al. Nucleoporin NUP153 guards genome integrity by promoting nuclear import of 53BP1. Cell Death Differ. 2012;19:798-807 pubmed publisher
E X, Pickering M, Debatis M, Castillo J, Lagadinos A, Wang S, et al. An E2F1-mediated DNA damage response contributes to the replication of human cytomegalovirus. PLoS Pathog. 2011;7:e1001342 pubmed publisher
Demogines A, East A, Lee J, Grossman S, Sabeti P, Paull T, et al. Ancient and recent adaptive evolution of primate non-homologous end joining genes. PLoS Genet. 2010;6:e1001169 pubmed publisher
Inoue S, Yoshinari K, Sugawara M, Yamazoe Y. Activated sterol regulatory element-binding protein-2 suppresses hepatocyte nuclear factor-4-mediated Cyp3a11 expression in mouse liver. Mol Pharmacol. 2011;79:148-56 pubmed publisher
Cha H, Lowe J, Li H, Lee J, Belova G, Bulavin D, et al. Wip1 directly dephosphorylates gamma-H2AX and attenuates the DNA damage response. Cancer Res. 2010;70:4112-22 pubmed publisher
Mandriota S, Buser R, Lesne L, Stouder C, Favaudon V, Maechler P, et al. Ataxia telangiectasia mutated (ATM) inhibition transforms human mammary gland epithelial cells. J Biol Chem. 2010;285:13092-106 pubmed publisher
Lee J, Goodarzi A, Jeggo P, Paull T. 53BP1 promotes ATM activity through direct interactions with the MRN complex. EMBO J. 2010;29:574-85 pubmed publisher
Lins S, Kim R, Krüger L, Chrzanowska K, Seemanova E, Digweed M. Clinical variability and expression of the NBN c.657del5 allele in Nijmegen Breakage Syndrome. Gene. 2009;447:12-7 pubmed publisher
Collaco R, Bevington J, Bhrigu V, Kalman Maltese V, Trempe J. Adeno-associated virus and adenovirus coinfection induces a cellular DNA damage and repair response via redundant phosphatidylinositol 3-like kinase pathways. Virology. 2009;392:24-33 pubmed publisher
Bartkova J, Tommiska J, Oplustilova L, Aaltonen K, Tamminen A, Heikkinen T, et al. Aberrations of the MRE11-RAD50-NBS1 DNA damage sensor complex in human breast cancer: MRE11 as a candidate familial cancer-predisposing gene. Mol Oncol. 2008;2:296-316 pubmed publisher
Zheng L, Kanagaraj R, Mihaljevic B, Schwendener S, Sartori A, Gerrits B, et al. MRE11 complex links RECQ5 helicase to sites of DNA damage. Nucleic Acids Res. 2009;37:2645-57 pubmed publisher
Spycher C, Miller E, Townsend K, Pavic L, Morrice N, Janscak P, et al. Constitutive phosphorylation of MDC1 physically links the MRE11-RAD50-NBS1 complex to damaged chromatin. J Cell Biol. 2008;181:227-40 pubmed publisher
den Dulk B, van Eijk P, de Ruijter M, Brandsma J, Brouwer J. The NER protein Rad33 shows functional homology to human Centrin2 and is involved in modification of Rad4. DNA Repair (Amst). 2008;7:858-68 pubmed publisher
Takemura H, Rao V, Sordet O, Furuta T, Miao Z, Meng L, et al. Defective Mre11-dependent activation of Chk2 by ataxia telangiectasia mutated in colorectal carcinoma cells in response to replication-dependent DNA double strand breaks. J Biol Chem. 2006;281:30814-23 pubmed
Krüger L, Demuth I, Neitzel H, Varon R, Sperling K, Chrzanowska K, et al. Cancer incidence in Nijmegen breakage syndrome is modulated by the amount of a variant NBS protein. Carcinogenesis. 2007;28:107-11 pubmed
Cerosaletti K, Concannon P. Independent roles for nibrin and Mre11-Rad50 in the activation and function of Atm. J Biol Chem. 2004;279:38813-9 pubmed
product information
brand :
Novus
catalog number base :
NBP1-89342
SKU :
NBP1-89342
product name :
ATP6V0A1 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The ATP6V0A1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ATP6V0A1. This antibody reacts with human,mouse. The ATP6V0A1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
ATP6V0A1
category :
Primary Antibodies
buffer :
PBS (pH 7.2), 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIR
KANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEIN
TNQEALKRNFLELTELK
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
ATP6V0A1
review stars :
4
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]
applications :
Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.