SLC1A5 Antibody - BSA Free | Novus Biologicals NBP1-89327 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SLC1A5 Antibody - BSA Free

catalog :

NBP1-89327

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

197C193 (IM193)

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, proximity ligation assay

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Benichou E, Seffou B, Top xe7 u S, Renoult O, Lenoir V, Planchais J, et al. The transcription factor ChREBP Orchestrates liver carcinogenesis by coordinating the PI3K/AKT signaling and cancer metabolism. Nat Commun. 2024;15:1879 pubmed publisher
Liu Y, Liu T, Zhou Y, Li W, Wang M, Song N, et al. Impeding the combination of astrocytic ASCT2 and NLRP3 by talniflumate alleviates neuroinflammation in experimental models of Parkinson's disease. Acta Pharm Sin B. 2023;13:662-677 pubmed publisher
Romanet S, Aschenbach J, Pieper R, Zentek J, Htoo J, Whelan R, et al. Expression of proposed methionine transporters along the gastrointestinal tract of pigs and their regulation by dietary methionine sources. Genes Nutr. 2021;16:14 pubmed publisher
Wu W, Sun H, Chen J, OuYang H, Yu X, Chen H, et al. Immunosuppressive Immature Myeloid Cell Generation Is Controlled by Glutamine Metabolism in Human Cancer. Cancer Immunol Res. 2019;7:1605-1618 pubmed publisher
Sun H, Yu X, Wu W, Chen J, Shi M, Zheng L, et al. GLUT1 and ASCT2 as Predictors for Prognosis of Hepatocellular Carcinoma. PLoS ONE. 2016;11:e0168907 pubmed publisher
Carpenter R, Paw I, Zhu H, Sirkisoon S, Xing F, Watabe K, et al. The gain-of-function GLI1 transcription factor TGLI1 enhances expression of VEGF-C and TEM7 to promote glioblastoma angiogenesis. Oncotarget. 2015;6:22653-65 pubmed
Mehran R, Nilsson M, Khajavi M, Du Z, Cascone T, Wu H, et al. Tumor endothelial markers define novel subsets of cancer-specific circulating endothelial cells associated with antitumor efficacy. Cancer Res. 2014;74:2731-41 pubmed publisher
Yamaji Y, Yoshida S, Ishikawa K, Sengoku A, Sato K, Yoshida A, et al. TEM7 (PLXDC1) in neovascular endothelial cells of fibrovascular membranes from patients with proliferative diabetic retinopathy. Invest Ophthalmol Vis Sci. 2008;49:3151-7 pubmed publisher
Fuchs B, Mahlum E, Halder C, Maran A, Yaszemski M, Bode B, et al. High expression of tumor endothelial marker 7 is associated with metastasis and poor survival of patients with osteogenic sarcoma. Gene. 2007;399:137-43 pubmed
Meng F, Henson R, Patel T. Chemotherapeutic stress selectively activates NF-kappa B-dependent AKT and VEGF expression in liver cancer-derived endothelial cells. Am J Physiol Cell Physiol. 2007;293:C749-60 pubmed
Lee H, Kang D, Seo I, Choi E, Park H, Park J. Expression of tumor endothelial marker 7 mRNA and protein in the dorsal root ganglion neurons of the rat. Neurosci Lett. 2006;402:71-5 pubmed
Lee H, Bae H, Park H, Seo I, Lee E, Suh D, et al. Cloning, characterization and neuronal expression profiles of tumor endothelial marker 7 in the rat brain. Brain Res Mol Brain Res. 2005;136:189-98 pubmed
Nanda A, Buckhaults P, Seaman S, Agrawal N, Boutin P, Shankara S, et al. Identification of a binding partner for the endothelial cell surface proteins TEM7 and TEM7R. Cancer Res. 2004;64:8507-11 pubmed

product information

master code :

NBP1-89327

SKU :

NBP1-89327

product name :

SLC1A5 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SLC1A5 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SLC1A5. This antibody reacts with human,mouse,porcine. The SLC1A5 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Proximity Ligation Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

SLC1A5

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHY
RGPAGDATVASEKESVM
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Porcine

gene symbol :

SLC1A5

Antibody validation :

Orthogonal Validation

accessionNumbers :

Q15758

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Proximity Ligation Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

559 USD

alt names :

AAAT, Alanine/serine/cysteine transporter 2, ASC amino acid transporter-2, ASCT2, ATB(0), ATBO, Baboon M7 virus receptor, M7V1, M7VS1, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage