product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SLC1A5 Antibody - BSA Free
catalog :
NBP1-89327
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
197C193 (IM193)
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, proximity ligation assay
more info or order :
citations: 13
Reference
Benichou E, Seffou B, Top xe7 u S, Renoult O, Lenoir V, Planchais J, et al. The transcription factor ChREBP Orchestrates liver carcinogenesis by coordinating the PI3K/AKT signaling and cancer metabolism. Nat Commun. 2024;15:1879 pubmed publisher
Liu Y, Liu T, Zhou Y, Li W, Wang M, Song N, et al. Impeding the combination of astrocytic ASCT2 and NLRP3 by talniflumate alleviates neuroinflammation in experimental models of Parkinson's disease. Acta Pharm Sin B. 2023;13:662-677 pubmed publisher
Romanet S, Aschenbach J, Pieper R, Zentek J, Htoo J, Whelan R, et al. Expression of proposed methionine transporters along the gastrointestinal tract of pigs and their regulation by dietary methionine sources. Genes Nutr. 2021;16:14 pubmed publisher
Wu W, Sun H, Chen J, OuYang H, Yu X, Chen H, et al. Immunosuppressive Immature Myeloid Cell Generation Is Controlled by Glutamine Metabolism in Human Cancer. Cancer Immunol Res. 2019;7:1605-1618 pubmed publisher
Sun H, Yu X, Wu W, Chen J, Shi M, Zheng L, et al. GLUT1 and ASCT2 as Predictors for Prognosis of Hepatocellular Carcinoma. PLoS ONE. 2016;11:e0168907 pubmed publisher
Carpenter R, Paw I, Zhu H, Sirkisoon S, Xing F, Watabe K, et al. The gain-of-function GLI1 transcription factor TGLI1 enhances expression of VEGF-C and TEM7 to promote glioblastoma angiogenesis. Oncotarget. 2015;6:22653-65 pubmed
Mehran R, Nilsson M, Khajavi M, Du Z, Cascone T, Wu H, et al. Tumor endothelial markers define novel subsets of cancer-specific circulating endothelial cells associated with antitumor efficacy. Cancer Res. 2014;74:2731-41 pubmed publisher
Yamaji Y, Yoshida S, Ishikawa K, Sengoku A, Sato K, Yoshida A, et al. TEM7 (PLXDC1) in neovascular endothelial cells of fibrovascular membranes from patients with proliferative diabetic retinopathy. Invest Ophthalmol Vis Sci. 2008;49:3151-7 pubmed publisher
Fuchs B, Mahlum E, Halder C, Maran A, Yaszemski M, Bode B, et al. High expression of tumor endothelial marker 7 is associated with metastasis and poor survival of patients with osteogenic sarcoma. Gene. 2007;399:137-43 pubmed
Meng F, Henson R, Patel T. Chemotherapeutic stress selectively activates NF-kappa B-dependent AKT and VEGF expression in liver cancer-derived endothelial cells. Am J Physiol Cell Physiol. 2007;293:C749-60 pubmed
Lee H, Kang D, Seo I, Choi E, Park H, Park J. Expression of tumor endothelial marker 7 mRNA and protein in the dorsal root ganglion neurons of the rat. Neurosci Lett. 2006;402:71-5 pubmed
Lee H, Bae H, Park H, Seo I, Lee E, Suh D, et al. Cloning, characterization and neuronal expression profiles of tumor endothelial marker 7 in the rat brain. Brain Res Mol Brain Res. 2005;136:189-98 pubmed
Nanda A, Buckhaults P, Seaman S, Agrawal N, Boutin P, Shankara S, et al. Identification of a binding partner for the endothelial cell surface proteins TEM7 and TEM7R. Cancer Res. 2004;64:8507-11 pubmed
product information
brand :
Novus
catalog number base :
NBP1-89327
SKU :
NBP1-89327
product name :
SLC1A5 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The SLC1A5 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SLC1A5. This antibody reacts with human,mouse,porcine. The SLC1A5 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Proximity Ligation Assay,Immunocytochemistry/ Immunofluorescence.
target :
SLC1A5
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHY
RGPAGDATVASEKESVM
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Porcine
gene symbol :
SLC1A5
review stars :
5
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]
accessionNumbers :
Q15758
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Proximity Ligation Assay,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
AAAT, Alanine/serine/cysteine transporter 2, ASC amino acid transporter-2, ASCT2, ATB(0), ATBO, Baboon M7 virus receptor, M7V1, M7VS1, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RD114 virus receptor, RD114/simian type D retrovirus receptor, RDR, Sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino acid transporter), member 5, Solute carrier family 1 member 5
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.