FLNC Antibody - BSA Free | Novus Biologicals NBP1-89300 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FLNC Antibody - BSA Free

catalog :

NBP1-89300

quantity :

0.1 ml (also 25 ul)

price :

579 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Onn xe9 e M, B xe9 n xe9 zit A, Bastu S, Nadaj Pakleza A, Lannes B, Ader F, et al. The FLNC Ala1186Val Variant Linked to Cytoplasmic Body Myopathy and Cardiomyopathy Causes Protein Instability. Biomedicines. 2024;12: pubmed publisher
Yerra V, Batchu S, Kaur H, Kabir M, Liu Y, Advani S, et al. Pressure overload induces ISG15 to facilitate adverse ventricular remodeling and promote heart failure. J Clin Invest. 2023;133: pubmed publisher
Wu T, Xu Y, Zhang L, Liang Z, Zhou X, Evans S, et al. Filamin C is Essential for mammalian myocardial integrity. PLoS Genet. 2023;19:e1010630 pubmed publisher
Knyazeva A, Khudiakov A, Vaz R, Muravyev A, Sukhareva K, Sejersen T, et al. FLNC Expression Level Influences the Activity of TEAD-YAP/TAZ Signaling. Genes (Basel). 2020;11: pubmed publisher
Robertson R, Conte T, Dicaire M, Rymar V, Sadikot A, Bryson Richardson R, et al. BAG3P215L/KO Mice as a Model of BAG3P209L Myofibrillar Myopathy. Am J Pathol. 2020;190:554-562 pubmed publisher
Kiselev A, Vaz R, Knyazeva A, Khudiakov A, Tarnovskaya S, Liu J, et al. De novo mutations in FLNC leading to early-onset restrictive cardiomyopathy and congenital myopathy. Hum Mutat. 2018;39:1161-1172 pubmed publisher
Wu T, Mu Y, Bogomolovas J, Fang X, Veevers J, Nowak R, et al. HSPB7 is indispensable for heart development by modulating actin filament assembly. Proc Natl Acad Sci U S A. 2017;114:11956-11961 pubmed publisher

product information

master code :

NBP1-89300

SKU :

NBP1-89300

product name :

FLNC Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The FLNC Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FLNC. This antibody reacts with human,mouse. The FLNC Antibody - BSA Free has been validated for the following applications: Immunohistochemistry-Paraffin,Western Blot,Immunohistochemistry,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.

target :

FLNC

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTP
CEEVYVKHMGNRVYNVTYTVKEKGDY
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

FLNC

Antibody validation :

Orthogonal Validation

applications :

Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence

USD :

579 USD

alt names :

ABP-280, ABP280A, ABP-280-like protein, ABPA, ABP-L, ABPLABP-L, gamma filamin, Actin-binding-like protein, filamin 2, filamin C, gamma, filamin C, gamma (actin binding protein 280), Filamin-2, filamin-C, FLJ10186, FLN2actin binding protein 280, FLNc, FLN-C, Gamma-filamin

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage