ADNP Antibody - BSA Free | Novus Biologicals NBP1-89236 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ADNP Antibody - BSA Free

catalog :

NBP1-89236

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Magr xec B, D Amico A, Maugeri G, Morello G, La Cognata V, Saccone S, et al. Neuroprotective effect of the PACAP-ADNP axis on SOD1G93A mutant motor neuron death induced by trophic factors deprivation. Neuropeptides. 2023;102:102386 pubmed publisher
D Amico A, Maugeri G, Magr xec B, Lombardo C, Saccone S, Federico C, et al. PACAP-ADNP axis prevents outer retinal barrier breakdown and choroidal neovascularization by interfering with VEGF secreted from retinal pigmented epitelium cells. Peptides. 2023;168:171065 pubmed publisher
Ferreira A, Szeto A, Clark P, Crisp A, Kozik P, Jolin H, et al. Neuroprotective protein ADNP-dependent histone remodeling complex promotes T helper 2 immune cell differentiation. Immunity. 2023;56:1468-1484.e7 pubmed publisher
Donnelly G, Moore I. Sports Medicine and the Pelvic Floor. Curr Sports Med Rep. 2023;22:82-90 pubmed publisher
Maugeri G, D Amico A, Giunta S, Giallongo C, Tibullo D, Bucolo C, et al. Activity-Dependent Neuroprotective Protein (ADNP)-Derived Peptide (NAP) Counteracts UV-B Radiation-Induced ROS Formation in Corneal Epithelium. Antioxidants (Basel). 2022;11: pubmed publisher
Yang M, Chen Y, Tu S, Chi P, Chuang K, Chang C, et al. Utilizing an Animal Model to Identify Brain Neurodegeneration-Related Biomarkers in Aging. Int J Mol Sci. 2021;22: pubmed publisher
Cesur G, Eren M, Eren E, Ergin K, Ek R, Yildiz Y, et al. Effect of experimentally induced hypothyroidism during gestation period on activity dependent neurotrophic factor (ADNF) in newborn rat brain tissue. Horm Mol Biol Clin Investig. 2018;36: pubmed publisher

product information

master code :

NBP1-89236

SKU :

NBP1-89236

product name :

ADNP Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The ADNP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ADNP. This antibody reacts with human,mouse,rabbit,rat. The ADNP Antibody - BSA Free has been validated for the following applications: Immunoprecipitation,Knockdown Validated,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

ADNP

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKL
DQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWK
DGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSED
ARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rabbit,Rat

gene symbol :

ADNP

Antibody validation :

Knockout/Knockdown

applications :

Immunoprecipitation,Knockdown Validated,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

Activity-dependent neuroprotective protein, activity-dependent neuroprotector, activity-dependent neuroprotector homeobox, ADNP homeobox 1, ADNP1KIAA0784activity-dependent neuroprotector homeobox protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage