FCRN/FCGRT Antibody - BSA Free | Novus Biologicals NBP1-89128 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FCRN/FCGRT Antibody - BSA Free

catalog :

NBP1-89128

quantity :

0.1 ml (also 25 ul)

price :

579 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 23

Reference
Zakrzewicz A, W xfc rth C, Beckert B, Feldhoff S, Vanderheyden K, Foss S, et al. Stabilization of Keratinocyte Monolayer Integrity in the Presence of Anti-Desmoglein-3 Antibodies through FcRn Blockade with Efgartigimod: Novel Treatment Paradigm for Pemphigus?. Cells. 2022;11: pubmed publisher
Uchida Y, Torisu K, Ueki K, Tsuruya K, Nakano T, Kitazono T. Autophagy gene ATG7 regulates albumin transcytosis in renal tubule epithelial cells. Am J Physiol Renal Physiol. 2021;321:F572-F586 pubmed publisher
Wang X, Zhang S, Ding Y, Tong H, Xu X, Wei G, et al. p47phox deficiency impairs platelet function and protects mice against arterial and venous thrombosis. Redox Biol. 2020;34:101569 pubmed publisher
Cao L, Li X, XU R, Yao K, Yang W, Zhu H, et al. DUOX2, a common modulator in preventive effects of monoamine-based antidepressants on water immersion restraint stress- and indomethacin- induced gastric mucosal damage. Eur J Pharmacol. 2020;876:173058 pubmed publisher
Shin S, Kim K, Kim S, Kwon O, Choi C, Jeong S, et al. Exogenous 8-hydroxydeoxyguanosine ameliorates liver fibrosis through the inhibition of Rac1-NADPH oxidase signaling. J Gastroenterol Hepatol. 2020;35:1078-1087 pubmed publisher
Catlin N, Mitchell A, Potchoiba M, O Hara D, Wang M, Zhang M, et al. Placental transfer of 125 iodinated humanized immunoglobulin G2Δa in the cynomolgus monkey. Birth Defects Res. 2020;112:105-117 pubmed publisher
Wang T, Su H, Lou W, Gu J, He X, Chen L, et al. Experimental supporting data on evaluation of skeletal muscle perfusion in canine hind limb ischemia model using color-coded digital subtraction angiography. Data Brief. 2019;25:103737 pubmed publisher
Diebold B, Wilder S, De Deken X, Meitzler J, Doroshow J, McCoy J, et al. Guidelines for the Detection of NADPH Oxidases by Immunoblot and RT-qPCR. Methods Mol Biol. 2019;1982:191-229 pubmed publisher
Pan C, Jin L, Wang X, Li Y, Chun J, Boese A, et al. Inositol-triphosphate 3-kinase B confers cisplatin resistance by regulating NOX4-dependent redox balance. J Clin Invest. 2019;129:2431-2445 pubmed publisher
Bequignon E, Dhommée C, Angely C, Thomas L, Bottier M, Escudier E, et al. FcRn-Dependent Transcytosis of Monoclonal Antibody in Human Nasal Epithelial Cells In Vitro: A Prerequisite for a New Delivery Route for Therapy?. Int J Mol Sci. 2019;20: pubmed publisher
Vara D, Cifuentes Pagano E, Pagano P, Pula G. A novel combinatorial technique for simultaneous quantification of oxygen radicals and aggregation reveals unexpected redox patterns in the activation of platelets by different physiopathological stimuli. Haematologica. 2019;: pubmed publisher
Raut P, Kim S, Choi D, Jeong G, Park P. Growth of breast cancer cells by leptin is mediated via activation of the inflammasome: Critical roles of estrogen receptor signaling and reactive oxygen species production. Biochem Pharmacol. 2019;161:73-88 pubmed publisher
Stuart J, Fonseca J, Moradi F, Cunningham C, Seliman B, Worsfold C, et al. How Supraphysiological Oxygen Levels in Standard Cell Culture Affect Oxygen-Consuming Reactions. Oxid Med Cell Longev. 2018;2018:8238459 pubmed publisher
Shin S, Cho J, Kim E, Kim E, Park D, Kwon K, et al. Anti-inflammatory and anti-apoptotic effects of rosuvastatin by regulation of oxidative stress in a dextran sulfate sodium-induced colitis model. World J Gastroenterol. 2017;23:4559-4568 pubmed publisher
Latvala S, Jacobsen B, Otteneder M, Herrmann A, Kronenberg S. Distribution of FcRn Across Species and Tissues. J Histochem Cytochem. 2017;65:321-333 pubmed publisher
Kangawa Y, Yoshida T, Maruyama K, Okamoto M, Kihara T, Nakamura M, et al. Cilostazol and enzymatically modified isoquercitrin attenuate experimental colitis and colon cancer in mice by inhibiting cell proliferation and inflammation. Food Chem Toxicol. 2017;100:103-114 pubmed publisher
Zimmermann N, Thormann V, Hu B, Köhler A, Imai Matsushima A, Locht C, et al. Human isotype-dependent inhibitory antibody responses against Mycobacterium tuberculosis. EMBO Mol Med. 2016;8:1325-1339 pubmed publisher
Wyssenbach A, Quintela T, Llavero F, Zugaza J, Matute C, Alberdi E. Amyloid β-induced astrogliosis is mediated by β1-integrin via NADPH oxidase 2 in Alzheimer's disease. Aging Cell. 2016;15:1140-1152 pubmed publisher
Dalloneau E, Baroukh N, Mavridis K, Maillet A, Gueugnon F, Courty Y, et al. Downregulation of the neonatal Fc receptor expression in non-small cell lung cancer tissue is associated with a poor prognosis. Oncotarget. 2016;7:54415-54429 pubmed publisher
Pekarčíková L, Knopfova L, Benes P, Smarda J. c-Myb regulates NOX1/p38 to control survival of colorectal carcinoma cells. Cell Signal. 2016;28:924-36 pubmed publisher
Kwon J, Wang A, Burke D, Boudreau H, Lekstrom K, Korzeniowska A, et al. Peroxiredoxin 6 (Prdx6) supports NADPH oxidase1 (Nox1)-based superoxide generation and cell migration. Free Radic Biol Med. 2016;96:99-115 pubmed publisher
Morel A, Passot C, Arnoult C, Dumans A, Beaumont E, Gouilleux Gruart V, et al. The neonatal Fc receptor does not modulate hepatitis C virus neutralization. J Gen Virol. 2015;96:1062-6 pubmed publisher
Zhao Q, Viswanadhapalli S, Williams P, Shi Q, Tan C, Yi X, et al. NADPH oxidase 4 induces cardiac fibrosis and hypertrophy through activating Akt/mTOR and NFÎºB signaling pathways. Circulation. 2015;131:643-55 pubmed publisher

product information

master code :

NBP1-89128

SKU :

NBP1-89128

product name :

FCRN/FCGRT Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The FCRN/FCGRT Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FCRN/FCGRT. This antibody reacts with cynomolgus monkey,human,primate - macaca fascicularis (crab-eating monkey or cynomolgus macaque). The FCRN/FCGRT Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunohistochemistry,Simple Western,Knockout Validated.

target :

FCRN/FCGRT

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSS
PGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPN
SDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELE
SPAKS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Cynomolgus Monkey,Human,Primate - Macaca fascicularis (Crab-eating Monkey or Cynomolgus Macaque)

theoretical molecular weight :

40 kDa

gene symbol :

FCGRT

Antibody validation :

Knockout/Knockdown

accessionNumbers :

P55899

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunohistochemistry,Simple Western,Knockout Validated

USD :

579 USD

alt names :

alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage