VAP-B Antibody - BSA Free | Novus Biologicals NBP1-89112 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

VAP-B Antibody - BSA Free

catalog :

NBP1-89112

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

SC-35

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Kim K, Lee Y, Jeong S, Kim D, Chon S, Pak Y, et al. A Small Molecule, 4-Phenylbutyric Acid, Suppresses HCV Replication via Epigenetically Induced Hepatic Hepcidin. Int J Mol Sci. 2020;21: pubmed publisher
Wu N, Nguyen X, Wang L, Appourchaux R, Zhang C, Panthu B, et al. The interferon stimulated gene 20 protein (ISG20) is an innate defense antiviral factor that discriminates self versus non-self translation. PLoS Pathog. 2019;15:e1008093 pubmed publisher
Malik A, Miguez R, Li X, Ho Y, Feldman E, Barmada S. Matrin 3-dependent neurotoxicity is modified by nucleic acid binding and nucleocytoplasmic localization. elife. 2018;7: pubmed publisher
Grindheim A, Hollås H, Raddum A, Saraste J, Vedeler A. Reactive oxygen species exert opposite effects on Tyr23 phosphorylation of the nuclear and cortical pools of annexin A2. J Cell Sci. 2016;129:314-28 pubmed publisher
Sytnikova Y, Kubarenko A, Sch fer A, Weber A, Niehrs C. Gadd45a is an RNA binding protein and is localized in nuclear speckles. PLoS ONE. 2011;6:e14500 pubmed publisher
Nie G, Hampton A, Fu G, Liu Y, Findlay J, Salamonsen L. A potential molecular mechanism for regulating pre-mRNA splicing of implantation-related genes through unique uterine expression of splicing factor SC35 in women and rhesus monkeys. Reproduction. 2002;124:209-17 pubmed

product information

master code :

NBP1-89112

SKU :

NBP1-89112

product name :

VAP-B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The VAP-B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to VAP-B. This antibody reacts with human,mouse,rat. The VAP-B Antibody - BSA Free has been validated for the following applications: Immunoprecipitation,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

VAP-B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIIST
TASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQR
LREENKQFKEEDGLRMRKTVQSNSPISALAPTGK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

VAPB

Antibody validation :

Orthogonal Validation

applications :

Immunoprecipitation,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

ALS8VAMP-B/VAMP-C, VAMP (vesicle-associated membrane protein)-associated protein B and C, VAMP-associated 33 kDa protein, VAMP-associated protein B/C, VAMP-B, VAP-B, VAP-B/VAP-C, VAPC, VAP-C, vesicle-associated membrane protein-associated protein B/C

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage