RUNX2/CBFA1 Antibody - BSA Free | Novus Biologicals NBP1-89104 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RUNX2/CBFA1 Antibody - BSA Free

catalog :

NBP1-89104

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Tsutsumi Arai C, Arai Y, Tran A, Salinas M, Nakai Y, Orikasa S, et al. A PTHrP Gradient Drives Mandibular Condylar Chondrogenesis via Runx2. J Dent Res. 2024;103:91-100 pubmed publisher
Sridhar A, Hoshino A, Finkbeiner C, Chitsazan A, Dai L, Haugan A, et al. Single-Cell Transcriptomic Comparison of Human Fetal Retina, hPSC-Derived Retinal Organoids, and Long-Term Retinal Cultures. Cell Rep. 2020;30:1644-1659.e4 pubmed publisher
Khalmuratova R, Shin H, Kim D, Park J. Interleukin (IL)-13 and IL-17A contribute to neo-osteogenesis in chronic rhinosinusitis by inducing RUNX2. EBioMedicine. 2019;46:330-341 pubmed publisher
Mizuhashi K, Nagata M, Matsushita Y, Ono W, Ono N. Growth Plate Borderline Chondrocytes Behave as Transient Mesenchymal Precursor Cells. J Bone Miner Res. 2019;34:1387-1392 pubmed publisher
Capowski E, Samimi K, Mayerl S, Phillips M, Pinilla I, Howden S, et al. Reproducibility and staging of 3D human retinal organoids across multiple pluripotent stem cell lines. Development. 2019;146: pubmed publisher
Ferrari N, Riggio A, Mason S, McDonald L, King A, Higgins T, et al. Runx2 contributes to the regenerative potential of the mammary epithelium. Sci Rep. 2015;5:15658 pubmed publisher

product information

master code :

NBP1-89104

SKU :

NBP1-89104

product name :

RUNX2/CBFA1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The RUNX2/CBFA1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to RUNX2/CBFA1. This antibody reacts with human,mouse. The RUNX2/CBFA1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen,IF/IHC,Immunofluorescence,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

RUNX2/CBFA1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLS
QMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGP
FSDPRQFPSISSLTESRFSNPRMHYPA
This RUNX2/CBFA1 Antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

theoretical molecular weight :

56.6 kDa

gene symbol :

RUNX2

Antibody validation :

Knockout/Knockdown

applications :

Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen,IF/IHC,Immunofluorescence,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

Acute myeloid leukemia 3 protein, CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, core-binding factor, runt domain, alpha subunit 1, MGC120023, ML3, oncogene AML-3, OSF2, OSF-2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, PEBP2aA, PEBP2-alpha A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt domain, alpha subunit 1, runt related transcription factor 2, runt-related transcription factor 2, RUNX2, SL3/AKV core-binding factor alpha A subunit, SL3-3 enhancer factor 1 alpha A subunit

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage