c-Fos Antibody - BSA Free | Novus Biologicals NBP1-89065 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

c-Fos Antibody - BSA Free

catalog :

NBP1-89065

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

1B5

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Tanaka S, Toriumi T, Ito T, Okuwa Y, Futenma T, Otake K, et al. Histological analysis of dental pulp response in immature or mature teeth after extra-oral subcutaneous transplantation into mice dorsum. J Oral Sci. 2021;63:184-190 pubmed publisher
Zabini D, Crnkovic S, Xu H, Tscherner M, Ghanim B, Klepetko W, et al. High-mobility group box-1 induces vascular remodelling processes via c-Jun activation. J Cell Mol Med. 2015;19:1151-61 pubmed publisher
Li P, Itoh N, Watanabe M, Shi Y, Liu P, Yang H, et al. Association of simian virus 40 vp1 with 70-kilodalton heat shock proteins and viral tumor antigens. J Virol. 2009;83:37-46 pubmed publisher
Lu H, Sun T, Matsuzaki T, Yi X, Eswara J, Bouley R, et al. Heat shock protein 70 interacts with aquaporin-2 and regulates its trafficking. J Biol Chem. 2007;282:28721-32 pubmed
Chen S, Brown I. Neuronal expression of constitutive heat shock proteins: implications for neurodegenerative diseases. Cell Stress Chaperones. 2007;12:51-8 pubmed
Tetzlaff J, Tanzer L, Jones K. Exogenous androgen treatment delays the stress response following hamster facial nerve injury. J Neuroendocrinol. 2007;19:383-9 pubmed
Meinander A, Söderström T, Kaunisto A, Poukkula M, Sistonen L, Eriksson J. Fever-like hyperthermia controls T Lymphocyte persistence by inducing degradation of cellular FLIPshort. J Immunol. 2007;178:3944-53 pubmed
Suttitanamongkol S, Polanowska Grabowska R, Gear A. Heat-shock protein 90 complexes in resting and thrombin-activated platelets. Biochem Biophys Res Commun. 2002;297:129-33 pubmed
Yamano T, Murata S, Shimbara N, Tanaka N, Chiba T, Tanaka K, et al. Two distinct pathways mediated by PA28 and hsp90 in major histocompatibility complex class I antigen processing. J Exp Med. 2002;196:185-96 pubmed
Bailey C, Andriola I, Kampinga H, Merry D. Molecular chaperones enhance the degradation of expanded polyglutamine repeat androgen receptor in a cellular model of spinal and bulbar muscular atrophy. Hum Mol Genet. 2002;11:515-23 pubmed
Brighty D, Jassal S. The synthetic peptide P-197 inhibits human T-cell leukemia virus type 1 envelope-mediated syncytium formation by a mechanism that is independent of Hsc70. J Virol. 2001;75:10472-8 pubmed
Sainis L, Angelidis C, Pagoulatos G, Lazaridis L. HSC70 interactions with SV40 viral proteins differ between permissive and nonpermissive mammalian cells. Cell Stress Chaperones. 2000;5:132-8 pubmed

product information

master code :

NBP1-89065

SKU :

NBP1-89065

product name :

c-Fos Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The c-Fos Antibody - BSA Free from Novus is a rabbit polyclonal antibody to c-Fos. This antibody reacts with human. The c-Fos Antibody - BSA Free has been validated for the following applications: Chromatin Immunoprecipitation-exo-Seq,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

c-Fos

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAG
VVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKM
AAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLK
EKEKLEFILAAHRPACKIPDDL
This c-Fos Antibody was developed against recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

FOS

applications :

Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

569 USD

alt names :

activator protein 1, AP-1, cellular oncogene c-fos, Cellular oncogene fos, C-FOS, FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS), FBJ murine osteosarcoma viral oncogene homolog, FOS, Fos proto-oncogene, AP-1 trancription factor subunit, G0/G1 switch regulatory protein 7, G0S7, p55, proto-oncogene c-Fos

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage