product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Rhot1 Antibody - BSA Free
catalog :
NBP1-89011
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 9
Reference
Lee H, Jeong O, Park H, Lee S, Bok E, Kim M, et al. Promising Therapeutic Effects of Embryonic Stem Cells-Origin Mesenchymal Stem Cells in Experimental Pulmonary Fibrosis Models: Immunomodulatory and Anti-Apoptotic Mechanisms. Immune Netw. 2023;23:e45 pubmed publisher
Fagbadebo F, Kaiser P, Zittlau K, Bartlick N, Wagner T, Froehlich T, et al. A Nanobody-Based Toolset to Monitor and Modify the Mitochondrial GTPase Miro1. Front Mol Biosci. 2022;9:835302 pubmed publisher
Furnish M, Boulton D, Genther V, Grofova D, Ellinwood M, Romero L, et al. MIRO2 Regulates Prostate Cancer Cell Growth via GCN1-Dependent Stress Signaling. Mol Cancer Res. 2022;20:607-621 pubmed publisher
Erdogan S, Türkekul K, Dibirdik I, Doganlar O, Doganlar Z, Bilir A, et al. Midkine downregulation increases the efficacy of quercetin on prostate cancer stem cell survival and migration through PI3K/AKT and MAPK/ERK pathway. Biomed Pharmacother. 2018;107:793-805 pubmed publisher
Li J, Luco A, Ochietti B, Fadhil I, Camirand A, Reinhardt T, et al. Tumoral Vitamin D Synthesis by CYP27B1 1-?-Hydroxylase Delays Mammary Tumor Progression in the PyMT-MMTV Mouse Model and Its Action Involves NF-?B Modulation. Endocrinology. 2016;157:2204-16 pubmed publisher
Xu Y, Romero R, Miller D, Kadam L, Mial T, Plazyo O, et al. An M1-like Macrophage Polarization in Decidual Tissue during Spontaneous Preterm Labor That Is Attenuated by Rosiglitazone Treatment. J Immunol. 2016;196:2476-2491 pubmed publisher
Stephen T, Higgs N, Sheehan D, Al Awabdh S, López Doménech G, Arancibia Carcamo I, et al. Miro1 Regulates Activity-Driven Positioning of Mitochondria within Astrocytic Processes Apposed to Synapses to Regulate Intracellular Calcium Signaling. J Neurosci. 2015;35:15996-6011 pubmed publisher
Kanfer G, Courtheoux T, Peterka M, Meier S, Soste M, Melnik A, et al. Mitotic redistribution of the mitochondrial network by Miro and Cenp-F. Nat Commun. 2015;6:8015 pubmed publisher
Jaworski S, Sawosz E, Kutwin M, Wierzbicki M, Hinzmann M, Grodzik M, et al. In vitro and in vivo effects of graphene oxide and reduced graphene oxide on glioblastoma. Int J Nanomedicine. 2015;10:1585-96 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-89011
SKU :
NBP1-89011
product name :
Rhot1 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The Rhot1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Rhot1. This antibody reacts with human,rat. The Rhot1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
Rhot1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSID
KVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMET
ILPIMNQYTEIE
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Rat
gene symbol :
RHOT1
top caption :
Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-89011]
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.