Rhot1 Antibody - BSA Free | Novus Biologicals NBP1-89011 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Rhot1 Antibody - BSA Free

catalog :

NBP1-89011

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Lee H, Jeong O, Park H, Lee S, Bok E, Kim M, et al. Promising Therapeutic Effects of Embryonic Stem Cells-Origin Mesenchymal Stem Cells in Experimental Pulmonary Fibrosis Models: Immunomodulatory and Anti-Apoptotic Mechanisms. Immune Netw. 2023;23:e45 pubmed publisher
Fagbadebo F, Kaiser P, Zittlau K, Bartlick N, Wagner T, Froehlich T, et al. A Nanobody-Based Toolset to Monitor and Modify the Mitochondrial GTPase Miro1. Front Mol Biosci. 2022;9:835302 pubmed publisher
Furnish M, Boulton D, Genther V, Grofova D, Ellinwood M, Romero L, et al. MIRO2 Regulates Prostate Cancer Cell Growth via GCN1-Dependent Stress Signaling. Mol Cancer Res. 2022;20:607-621 pubmed publisher
Erdogan S, Türkekul K, Dibirdik I, Doganlar O, Doganlar Z, Bilir A, et al. Midkine downregulation increases the efficacy of quercetin on prostate cancer stem cell survival and migration through PI3K/AKT and MAPK/ERK pathway. Biomed Pharmacother. 2018;107:793-805 pubmed publisher
Li J, Luco A, Ochietti B, Fadhil I, Camirand A, Reinhardt T, et al. Tumoral Vitamin D Synthesis by CYP27B1 1-?-Hydroxylase Delays Mammary Tumor Progression in the PyMT-MMTV Mouse Model and Its Action Involves NF-?B Modulation. Endocrinology. 2016;157:2204-16 pubmed publisher
Xu Y, Romero R, Miller D, Kadam L, Mial T, Plazyo O, et al. An M1-like Macrophage Polarization in Decidual Tissue during Spontaneous Preterm Labor That Is Attenuated by Rosiglitazone Treatment. J Immunol. 2016;196:2476-2491 pubmed publisher
Stephen T, Higgs N, Sheehan D, Al Awabdh S, LÃ³pez DomÃ©nech G, Arancibia Carcamo I, et al. Miro1 Regulates Activity-Driven Positioning of Mitochondria within Astrocytic Processes Apposed to Synapses to Regulate Intracellular Calcium Signaling. J Neurosci. 2015;35:15996-6011 pubmed publisher
Kanfer G, Courtheoux T, Peterka M, Meier S, Soste M, Melnik A, et al. Mitotic redistribution of the mitochondrial network by Miro and Cenp-F. Nat Commun. 2015;6:8015 pubmed publisher
Jaworski S, Sawosz E, Kutwin M, Wierzbicki M, Hinzmann M, Grodzik M, et al. In vitro and in vivo effects of graphene oxide and reduced graphene oxide on glioblastoma. Int J Nanomedicine. 2015;10:1585-96 pubmed publisher

product information

master code :

NBP1-89011

SKU :

NBP1-89011

product name :

Rhot1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Rhot1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Rhot1. This antibody reacts with human,rat. The Rhot1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Rhot1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSID
KVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMET
ILPIMNQYTEIE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Rat

gene symbol :

RHOT1

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage