product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ARID1A Antibody - BSA Free
catalog :
NBP1-88932
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 19
Reference
Hirt C, Booij T, Grob L, Simmler P, Toussaint N, Keller D, et al. Drug screening and genome editing in human pancreatic cancer organoids identifies drug-gene interactions and candidates for off-label treatment. Cell Genom. 2022;2:100095 pubmed publisher
Ren Z, Guo C, He H, Zuo Z, Hu Y, Yu S, et al. Effects of deoxynivalenol on mitochondrial dynamics and autophagy in pig spleen lymphocytes. Food Chem Toxicol. 2020;140:111357 pubmed publisher
Raynor J, Liu C, Dhungana Y, Guy C, Chapman N, Shi H, et al. Hippo/Mst signaling coordinates cellular quiescence with terminal maturation in iNKT cell development and fate decisions. J Exp Med. 2020;217: pubmed publisher
Zakarya R, Sapkota A, Chan Y, Shah J, Saad S, Bottle S, et al. Nitroxides affect neurological deficits and lesion size induced by a rat model of traumatic brain injury. Nitric Oxide. 2020;97:57-65 pubmed publisher
Markowska A, Szarszewska M, Knapp P, Gryboś A, Grybos M, Marszalek A, et al. The role of nesfatin and selected molecular factors in various types of endometrial cancer. Ginekol Pol. 2019;90:571-576 pubmed publisher
Chao T, Gómez B, Heard T, Smith B, Dubick M, Burmeister D. Burn-induced reductions in mitochondrial abundance and efficiency are more pronounced with small volumes of colloids in swine. Am J Physiol Cell Physiol. 2019;317:C1229-C1238 pubmed publisher
Chang J, Chang H, Wu Y, Cheng W, Lin T, Chang H, et al. Mitochondrial transplantation regulates antitumour activity, chemoresistance and mitochondrial dynamics in breast cancer. J Exp Clin Cancer Res. 2019;38:30 pubmed publisher
Markowska A, Szarszewska M, Zurawski J, Sajdak S, Knapp P, Gryboś A, et al. Studies on selected molecular factors in endometrial cancers. Adv Clin Exp Med. 2018;27:1417-1424 pubmed publisher
Chen H, Chan Y, Linnane C, Mao Y, Anwer A, Sapkota A, et al. L-Carnitine and extendin-4 improve outcomes following moderate brain contusion injury. Sci Rep. 2018;8:11201 pubmed publisher
Du X, Wen J, Wang Y, Karmaus P, Khatamian A, Tan H, et al. Hippo/Mst signalling couples metabolic state and immune function of CD8α+ dendritic cells. Nature. 2018;558:141-145 pubmed publisher
Chan Y, Saad S, Al Odat I, Oliver B, Pollock C, Jones N, et al. Maternal L-Carnitine Supplementation Improves Brain Health in Offspring from Cigarette Smoke Exposed Mothers. Front Mol Neurosci. 2017;10:33 pubmed publisher
Tan L, Toops K, Lakkaraju A. Protective responses to sublytic complement in the retinal pigment epithelium. Proc Natl Acad Sci U S A. 2016;113:8789-94 pubmed publisher
Bohovych I, Fernandez M, Rahn J, Stackley K, Bestman J, Anandhan A, et al. Metalloprotease OMA1 Fine-tunes Mitochondrial Bioenergetic Function and Respiratory Supercomplex Stability. Sci Rep. 2015;5:13989 pubmed publisher
Abe H, Hayashi A, Kunita A, Sakamoto Y, Hasegawa K, Shibahara J, et al. Altered expression of AT-rich interactive domain 1A in hepatocellular carcinoma. Int J Clin Exp Pathol. 2015;8:2763-70 pubmed
Uehara Y, Oda K, Ikeda Y, Koso T, Tsuji S, Yamamoto S, et al. Integrated copy number and expression analysis identifies profiles of whole-arm chromosomal alterations and subgroups with favorable outcome in ovarian clear cell carcinomas. PLoS ONE. 2015;10:e0128066 pubmed publisher
He F, Li J, Xu J, Zhang S, Xu Y, Zhao W, et al. Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma. J Exp Clin Cancer Res. 2015;34:47 pubmed publisher
Yue M, Hinkle K, Davies P, Trushina E, Fiesel F, Christenson T, et al. Progressive dopaminergic alterations and mitochondrial abnormalities in LRRK2 G2019S knock-in mice. Neurobiol Dis. 2015;78:172-95 pubmed publisher
Inada R, Sekine S, Taniguchi H, Tsuda H, Katai H, Fujiwara T, et al. ARID1A expression in gastric adenocarcinoma: clinicopathological significance and correlation with DNA mismatch repair status. World J Gastroenterol. 2015;21:2159-68 pubmed publisher
Bitler B, Aird K, Garipov A, Li H, Amatangelo M, Kossenkov A, et al. Synthetic lethality by targeting EZH2 methyltransferase activity in ARID1A-mutated cancers. Nat Med. 2015;21:231-8 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-88932
SKU :
NBP1-88932
product name :
ARID1A Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The ARID1A Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ARID1A. This antibody reacts with human,mouse. The ARID1A Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
ARID1A
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGA
PQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQF
STQGTPSGSPFPSQQTTMYQQQQQNYK
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
ARID1A
top caption :
Western Blot: ARID1A Antibody [NBP1-88932]
accessionNumbers :
O14497
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
ARID domain-containing protein 1A, AT rich interactive domain 1A (SWI- like), AT rich interactive domain 1A (SWI-like), AT-rich interactive domain-containing protein 1A, B120SWI-like protein, BAF250a, BAF250SWI/SNF complex protein p270, BM029, brain protein 120, BRG1-associated factor 250, BRG1-associated factor 250a, C10rf4, C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1, chromatin remodeling factor p250, hELD, hOSA1, matrix associated, actin dependent regulator of chromatin, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, subfamily f, member 1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.