product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
LPCAT1 Antibody - BSA Free
catalog :
NBP1-88923
quantity :
0.1 ml (also 25 ul)
price :
549 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
master code :
NBP1-88923
SKU :
NBP1-88923
product name :
LPCAT1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The LPCAT1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to LPCAT1. This antibody reacts with human,mouse. The LPCAT1 Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
LPCAT1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGL
GLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPV
SDLLEDMFSLFDESGSGEVDLRECVVALSV
This antibody was developed against Recombinant Protein corresponding to amino acids:
GLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPV
SDLLEDMFSLFDESGSGEVDLRECVVALSV
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
LPCAT1
Antibody validation :
Independent Anitbodies
applications :
Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
549 USD
alt names :
1-acylglycerophosphocholine O-acyltransferase, Acetyl-CoA:lyso-PAF acetyltransferase, Acetyl-CoA:lyso-platelet-activating factor acetyltransferase, acyl-CoA:lysophosphatidylcholine acyltransferase 1, acyltransferase like 2, Acyltransferase-like 2, AYTL2, EC 2.3.1.-, EC 2.3.1.23,1-alkylglycerophosphocholine O-acetyltransferase, EC 2.3.1.67, FLJ12443, FLJ41609, LPC acyltransferase 1, lpcat, LPCAT-1, Lyso-PAF acetyltransferase, lysoPAFAT, LysoPC acyltransferase 1, lysophosphatidylcholine acyltransferase 1, PFAAP3, Phosphonoformate immuno-associated protein 3, regulated by phosphonoformate
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
