LPCAT2 Antibody - BSA Free | Novus Biologicals NBP1-88921 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

LPCAT2 Antibody - BSA Free

catalog :

NBP1-88921

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Abate W, Alrammah H, Kiernan M, Tonks A, Jackson S. Lysophosphatidylcholine acyltransferase 2 (LPCAT2) co-localises with TLR4 and regulates macrophage inflammatory gene expression in response to LPS. Sci Rep. 2020;10:10355 pubmed publisher
Liu Y, Xu D, Wang L, Du W, Zhang L, Xiang X. MBTPS2 exacerbates albuminuria in streptozotocin-induced type I diabetic nephropathy by promoting endoplasmic reticulum stress-mediated renal damage. Arch Physiol Biochem. 2020;:1-8 pubmed publisher
Xiao X, Zhuang X, Xu C, Chen H, Zhu W, Pang C, et al. ROBO4 deletion ameliorates PAF-mediated skin inflammation via regulating the mRNA translation efficiency of LPCAT1/LPCAT2 and the expression of PAF receptor. Int J Biol Sci. 2020;16:1086-1095 pubmed publisher
Ishii H, Saitoh M, Sakamoto K, Sakamoto K, Saigusa D, Kasai H, et al. Lipidome-based rapid diagnosis with machine learning for detection of TGF-β signalling activated area in head and neck cancer. Br J Cancer. 2020;122:995-1004 pubmed publisher
Lee H, Kim J, Hong S, Hwang I, Park S, Kim T, et al. Proteomics-based functional studies reveal that galectin-3 plays a protective role in the pathogenesis of intestinal Behçet's disease. Sci Rep. 2019;9:11716 pubmed publisher
Zhang W, Zhong W, Sun Q, Sun X, Zhou Z. Hepatic overproduction of 13-HODE due to ALOX15 upregulation contributes to alcohol-induced liver injury in mice. Sci Rep. 2017;7:8976 pubmed publisher
Helley M, Abate W, Jackson S, Bennett J, Thompson S. The expression of Toll-like receptor 4, 7 and co-receptors in neurochemical sub-populations of rat trigeminal ganglion sensory neurons. Neuroscience. 2015;310:686-98 pubmed publisher

product information

master code :

NBP1-88921

SKU :

NBP1-88921

product name :

LPCAT2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The LPCAT2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to LPCAT2. This antibody reacts with human,mouse,rat. The LPCAT2 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.

target :

LPCAT2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFK
LFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQ
GDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPK
EVQTTPSTASNKVSPE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

LPCAT2

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen

USD :

559 USD

alt names :

1-alkylglycerophosphocholine O-acetyltransferase, Acetyl-CoA:lyso-PAF acetyltransferase, Acetyl-CoA:lyso-platelet-activating factor acetyltransferase, acyl-CoA:lysophosphatidylcholine acyltransferase 2, acyltransferase like 1, Acyltransferase-like 1, AYTL1LysoPAFAT, DKFZp686H22112, EC 2.3.1, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.67,1-acylglycerophosphocholine O-acyltransferase, FLJ20481, LPC acyltransferase 2, LPCAT1, LPCAT-2, Lyso-PAF acetyltransferase, LysoPC acyltransferase 2, lysophosphatidylcholine acyltransferase 2, lyso-platelet-activating factor (PAF) acetyltransferase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage