product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
PARD3/Par3 Antibody - BSA Free
catalog :
NBP1-88861
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 13
Published Application/Species/Sample/DilutionReference
  • western blot; mouse; loading ...; fig 2a
Zhou Y, Ji H, Xu Q, Zhang X, Cao X, Chen Y, et al. Congenital biliary atresia is correlated with disrupted cell junctions and polarity caused by Cdc42 insufficiency in the liver. Theranostics. 2021;11:7262-7275 pubmed publisher
Wang J, Cheng X, Mei X, Wu H, Yu Q, Xiao M. The effect of Par3 on the cellular junctions and biological functions of odontoblast-lineage cells. Odontology. 2023;: pubmed publisher
Das A, Adhikary S, Chowdhury A, Barui A. Leveraging Substrate Stiffness to Promote Stem Cell Asymmetric Division via Mechanotransduction-Polarity Protein Axis and Its Bayesian Regression Analysis. Rejuvenation Res. 2022;25:59-69 pubmed publisher
Heinrich A, Bhandary B, Potter S, Ratner N, DeFalco T. Cdc42 activity in Sertoli cells is essential for maintenance of spermatogenesis. Cell Rep. 2021;37:109885 pubmed publisher
Engevik A, Krystofiak E, Kaji I, Meyer A, Weis V, Goldstein A, et al. Recruitment of Polarity Complexes and Tight Junction Proteins to the Site of Apical Bulk Endocytosis. Cell Mol Gastroenterol Hepatol. 2021;12:59-80 pubmed publisher
Ling J, Sckaff M, Tiwari M, Chen Y, Li J, Jones J, et al. RAS-mediated suppression of PAR3 and its effects on SCC initiation and tissue architecture occur independently of hyperplasia. J Cell Sci. 2020;133: pubmed publisher
Heinrich A, Potter S, Guo L, Ratner N, DeFalco T. Distinct Roles for Rac1 in Sertoli Cell Function during Testicular Development and Spermatogenesis. Cell Rep. 2020;31:107513 pubmed publisher
Shearer D, Mervis M, Manley E, Reddy A, Alford A. TSP1 and TSP2 deficiencies affect LOX protein distribution in the femoral diaphysis and pro-peptide removal in marrow-derived mesenchymal stem cells in vitro. Connect Tissue Res. 2019;60:495-506 pubmed publisher
Kielosto M, Eriksson J, Nummela P, Yin M, Hölttä E. Divergent roles of lysyl oxidase family members in ornithine decarboxylase- and RAS-transformed mouse fibroblasts and human melanoma cells. Oncotarget. 2018;9:37733-37752 pubmed publisher
Varona S, Orriols M, Galán M, Guadall A, Cañes L, Aguiló S, et al. Lysyl oxidase (LOX) limits VSMC proliferation and neointimal thickening through its extracellular enzymatic activity. Sci Rep. 2018;8:13258 pubmed publisher
Moreno Fortuny A, Bragg L, Cossu G, Roostalu U. MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation. Biol Open. 2017;6:1592-1601 pubmed publisher
Tuccilli C, Baldini E, Arlot Bonnemains Y, Chesnel F, Sorrenti S, De Vito C, et al. Expression and prognostic value of the cell polarity PAR complex members in thyroid cancer. Int J Oncol. 2017;: pubmed publisher
Voorhees A, DeLeon Pennell K, Ma Y, Halade G, Yabluchanskiy A, Iyer R, et al. Building a better infarct: Modulation of collagen cross-linking to increase infarct stiffness and reduce left ventricular dilation post-myocardial infarction. J Mol Cell Cardiol. 2015;85:229-39 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-88861
SKU :
NBP1-88861
product name :
PARD3/Par3 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The PARD3/Par3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PARD3/Par3. This antibody reacts with human,mouse. The PARD3/Par3 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Simple Western,Immunocytochemistry/ Immunofluorescence.
target :
PARD3/Par3
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGC
DDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVK
KPRNSKPSPVDSNR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
PARD3
review stars :
4
Antibody validation :
Orthogonal Validation
top caption :
Western Blot: PARD3/Par3 Antibody [NBP1-88861]
applications :
IF/IHC,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Simple Western,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
FLJ21015, par-3 partitioning defective 3 homolog (C. elegans), PAR3A, PAR3C.elegans) homolog
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.