PARD3/Par3 Antibody - BSA Free | Novus Biologicals NBP1-88861 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PARD3/Par3 Antibody - BSA Free

catalog :

NBP1-88861

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 13

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig 2a	Zhou Y, Ji H, Xu Q, Zhang X, Cao X, Chen Y, et al. Congenital biliary atresia is correlated with disrupted cell junctions and polarity caused by Cdc42 insufficiency in the liver. Theranostics. 2021;11:7262-7275 pubmed publisher
	Wang J, Cheng X, Mei X, Wu H, Yu Q, Xiao M. The effect of Par3 on the cellular junctions and biological functions of odontoblast-lineage cells. Odontology. 2023;: pubmed publisher
	Das A, Adhikary S, Chowdhury A, Barui A. Leveraging Substrate Stiffness to Promote Stem Cell Asymmetric Division via Mechanotransduction-Polarity Protein Axis and Its Bayesian Regression Analysis. Rejuvenation Res. 2022;25:59-69 pubmed publisher
	Heinrich A, Bhandary B, Potter S, Ratner N, DeFalco T. Cdc42 activity in Sertoli cells is essential for maintenance of spermatogenesis. Cell Rep. 2021;37:109885 pubmed publisher
	Engevik A, Krystofiak E, Kaji I, Meyer A, Weis V, Goldstein A, et al. Recruitment of Polarity Complexes and Tight Junction Proteins to the Site of Apical Bulk Endocytosis. Cell Mol Gastroenterol Hepatol. 2021;12:59-80 pubmed publisher
	Ling J, Sckaff M, Tiwari M, Chen Y, Li J, Jones J, et al. RAS-mediated suppression of PAR3 and its effects on SCC initiation and tissue architecture occur independently of hyperplasia. J Cell Sci. 2020;133: pubmed publisher
	Heinrich A, Potter S, Guo L, Ratner N, DeFalco T. Distinct Roles for Rac1 in Sertoli Cell Function during Testicular Development and Spermatogenesis. Cell Rep. 2020;31:107513 pubmed publisher
	Shearer D, Mervis M, Manley E, Reddy A, Alford A. TSP1 and TSP2 deficiencies affect LOX protein distribution in the femoral diaphysis and pro-peptide removal in marrow-derived mesenchymal stem cells in vitro. Connect Tissue Res. 2019;60:495-506 pubmed publisher
	Kielosto M, Eriksson J, Nummela P, Yin M, Hölttä E. Divergent roles of lysyl oxidase family members in ornithine decarboxylase- and RAS-transformed mouse fibroblasts and human melanoma cells. Oncotarget. 2018;9:37733-37752 pubmed publisher
	Varona S, Orriols M, Galán M, Guadall A, Cañes L, Aguiló S, et al. Lysyl oxidase (LOX) limits VSMC proliferation and neointimal thickening through its extracellular enzymatic activity. Sci Rep. 2018;8:13258 pubmed publisher
	Moreno Fortuny A, Bragg L, Cossu G, Roostalu U. MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation. Biol Open. 2017;6:1592-1601 pubmed publisher
	Tuccilli C, Baldini E, Arlot Bonnemains Y, Chesnel F, Sorrenti S, De Vito C, et al. Expression and prognostic value of the cell polarity PAR complex members in thyroid cancer. Int J Oncol. 2017;: pubmed publisher
	Voorhees A, DeLeon Pennell K, Ma Y, Halade G, Yabluchanskiy A, Iyer R, et al. Building a better infarct: Modulation of collagen cross-linking to increase infarct stiffness and reduce left ventricular dilation post-myocardial infarction. J Mol Cell Cardiol. 2015;85:229-39 pubmed publisher

product information

master code :

NBP1-88861

SKU :

NBP1-88861

product name :

PARD3/Par3 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The PARD3/Par3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PARD3/Par3. This antibody reacts with human,mouse. The PARD3/Par3 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Western Blot,Simple Western.

target :

PARD3/Par3

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGC
DDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVK
KPRNSKPSPVDSNR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

PARD3

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Simple Western

USD :

559 USD

alt names :

FLJ21015, par-3 partitioning defective 3 homolog (C. elegans), PAR3A, PAR3C.elegans) homolog

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage