product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ZEB1 Antibody - BSA Free
catalog :
NBP1-88845
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
10C2
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 29
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
| |
Maxia C, Murtas D, Isola M, Tamma R, Zucca I, Piras F, et al. Immunophenotypic characterization of telocyte-like cells in pterygium. Mol Vis. 2018;24:853-866 pubmed
| |
Adamska A, Araszkiewicz A, Pilacinski S, Gandecka A, Grzelka A, Kowalska K, et al. Dermal microvessel density and maturity is closely associated with atherogenic dyslipidemia and accumulation of advanced glycation end products in adult patients with type 1 diabetes. Microvasc Res. 2019;121:46-51 pubmed publisher
| |
Asnaghi L, Gezgin G, Tripathy A, Handa J, Merbs S, van der Velden P, et al. EMT-associated factors promote invasive properties of uveal melanoma cells. Mol Vis. 2015;21:919-29 pubmed
| |
Mock K, Preca B, Brummer T, Brabletz S, Stemmler M, Brabletz T. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget. 2015;6:14399-412 pubmed
| |
Loudig O, Brandwein Gensler M, Kim R, Lin J, Isayeva T, Liu C, et al. Illumina whole-genome complementary DNA-mediated annealing, selection, extension and ligation platform: assessing its performance in formalin-fixed, paraffin-embedded samples and identifying invasion pattern-related genes in oral squamous cell carcin. Hum Pathol. 2011;42:1911-22 pubmed publisher
| |
Wright L, Li J, Caldwell M, Wallace K, Johnson J, Svendsen C. Gene expression in human neural stem cells: effects of leukemia inhibitory factor. J Neurochem. 2003;86:179-95 pubmed
| |
Messam C, Hou J, Berman J, Major E. Analysis of the temporal expression of nestin in human fetal brain derived neuronal and glial progenitor cells. Brain Res Dev Brain Res. 2002;134:87-92 pubmed
|
product information
master code :
NBP1-88845
SKU :
NBP1-88845
product name :
ZEB1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The ZEB1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ZEB1. This antibody reacts with human,mouse. The ZEB1 Antibody - BSA Free has been validated for the following applications: Chromatin Immunoprecipitation-exo-Seq,Chromatin Immunoprecipitation Sequencing,Chemotaxis,Chip Cytometry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.
target :
ZEB1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
concentration :
0.2 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALN
AQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS
EPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPL
KMTNSPVLPVGST
This antibody was developed against Recombinant Protein corresponding to amino acids:
AQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS
EPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPL
KMTNSPVLPVGST
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
theoretical molecular weight :
124 kDa
gene symbol :
ZEB1
Antibody validation :
Orthogonal Validation
accessionNumbers :
P37275
applications :
Chromatin Immunoprecipitation Sequencing,Chemotaxis,Chip Cytometry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry
USD :
559 USD
alt names :
AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
