ZEB1 Antibody - BSA Free | Novus Biologicals NBP1-88845 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ZEB1 Antibody - BSA Free

catalog :

NBP1-88845

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

10C2

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 29

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:1000; loading ...; fig 1a	Bi J, Yang S, Li L, Dai Q, Borcherding N, Wagner B, et al. Metadherin enhances vulnerability of cancer cells to ferroptosis. Cell Death Dis. 2019;10:682 pubmed publisher
western blot; human; 1:1000; loading ...; fig s4a	Vanneste M, Huang Q, Li M, Moose D, Zhao L, STAMNES M, et al. High content screening identifies monensin as an EMT-selective cytotoxic compound. Sci Rep. 2019;9:1200 pubmed publisher
	Han Y, Villarreal Ponce A, Gutiérrez G, Nguyen Q, Sun P, Wu T, et al. Coordinate control of basal epithelial cell fate and stem cell maintenance by core EMT transcription factor Zeb1. Cell Rep. 2022;38:110240 pubmed publisher
	Feldker N, Ferrazzi F, Schuhwerk H, Widholz S, Guenther K, Frisch I, et al. Genome-wide cooperation of EMT transcription factor ZEB1 with YAP and AP-1 in breast cancer. EMBO J. 2020;:e103209 pubmed publisher
	Sabelström H, Petri R, Shchors K, Jandial R, Schmidt C, Sacheva R, et al. Driving Neuronal Differentiation through Reversal of an ERK1/2-miR-124-SOX9 Axis Abrogates Glioblastoma Aggressiveness. Cell Rep. 2019;28:2064-2079.e11 pubmed publisher
	Adamska A, Pilacinski S, Zozulinska Ziolkiewicz D, Gandecka A, Grzelka A, Konwerska A, et al. An increased skin microvessel density is associated with neurovascular complications in type 1 diabetes mellitus. Diab Vasc Dis Res. 2019;16:513-522 pubmed publisher
	Balzamino B, Esposito G, Marino R, Keller F, Micera A. Changes in vitreal protein profile and retina mRNAs in Reeler mice: NGF, IL33 and Müller cell activation. PLoS ONE. 2019;14:e0212732 pubmed publisher
	Maxia C, Murtas D, Isola M, Tamma R, Zucca I, Piras F, et al. Immunophenotypic characterization of telocyte-like cells in pterygium. Mol Vis. 2018;24:853-866 pubmed
	Adamska A, Araszkiewicz A, Pilacinski S, Gandecka A, Grzelka A, Kowalska K, et al. Dermal microvessel density and maturity is closely associated with atherogenic dyslipidemia and accumulation of advanced glycation end products in adult patients with type 1 diabetes. Microvasc Res. 2019;121:46-51 pubmed publisher
	Murtas D, Pilloni L, Diana A, Casula L, Tomei S, Piras F, et al. Tyrosinase and nestin immunohistochemical expression in melanocytic nevi as a histopathologic pattern to trace melanocyte differentiation and nevogenesis. Histochem Cell Biol. 2019;151:175-185 pubmed publisher
	Iwata R, Maruyama M, Ito T, Nakano Y, Kanemura Y, Koike T, et al. Establishment of a tumor sphere cell line from a metastatic brain neuroendocrine tumor. Med Mol Morphol. 2017;50:211-219 pubmed publisher
	Yao X, Sun S, Zhou X, Zhang Q, Guo W, Zhang L. Clinicopathological significance of ZEB-1 and E-cadherin proteins in patients with oral cavity squamous cell carcinoma. Onco Targets Ther. 2017;10:781-790 pubmed publisher
	BarbÃ¡chano A, FernÃ¡ndez Barral A, Pereira F, Segura M, OrdÃ³Ã±ez MorÃ¡n P, Carrillo de Santa Pau E, et al. SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150. Oncogene. 2016;35:2991-3003 pubmed publisher
	Asnaghi L, Gezgin G, Tripathy A, Handa J, Merbs S, van der Velden P, et al. EMT-associated factors promote invasive properties of uveal melanoma cells. Mol Vis. 2015;21:919-29 pubmed
	Mock K, Preca B, Brummer T, Brabletz S, Stemmler M, Brabletz T. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget. 2015;6:14399-412 pubmed
	Meidhof S, Brabletz S, Lehmann W, Preca B, Mock K, Ruh M, et al. ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat. EMBO Mol Med. 2015;7:831-47 pubmed publisher
	Isella C, Terrasi A, Bellomo S, Petti C, Galatola G, Muratore A, et al. Stromal contribution to the colorectal cancer transcriptome. Nat Genet. 2015;47:312-9 pubmed publisher
	Davidson B, Holth A, Hellesylt E, Tan T, Huang R, TropÃ© C, et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol. 2015;46:1-8 pubmed publisher
	Murtas D, Piras F, Minerba L, Maxia C, Ferreli C, Demurtas P, et al. Activated Notch1 expression is associated with angiogenesis in cutaneous melanoma. Clin Exp Med. 2015;15:351-60 pubmed publisher
	Heroux M, Chesnik M, Halligan B, Al Gizawiy M, Connelly J, Mueller W, et al. Comprehensive characterization of glioblastoma tumor tissues for biomarker identification using mass spectrometry-based label-free quantitative proteomics. Physiol Genomics. 2014;46:467-81 pubmed publisher
	Lai S, Piras F, Spiga S, Perra M, Minerba L, Piga M, et al. Nestin and vimentin colocalization affects the subcellular location of glucocorticoid receptor in cutaneous melanoma. Histopathology. 2013;62:487-98 pubmed publisher
	Kondo S, Wakisaka N, Muramatsu M, Zen Y, Endo K, Murono S, et al. Epstein-Barr virus latent membrane protein 1 induces cancer stem/progenitor-like cells in nasopharyngeal epithelial cell lines. J Virol. 2011;85:11255-64 pubmed publisher
	Loudig O, Brandwein Gensler M, Kim R, Lin J, Isayeva T, Liu C, et al. Illumina whole-genome complementary DNA-mediated annealing, selection, extension and ligation platform: assessing its performance in formalin-fixed, paraffin-embedded samples and identifying invasion pattern-related genes in oral squamous cell carcin. Hum Pathol. 2011;42:1911-22 pubmed publisher
	Porayette P, Gallego M, Kaltcheva M, Bowen R, Vadakkadath Meethal S, Atwood C. Differential processing of amyloid-beta precursor protein directs human embryonic stem cell proliferation and differentiation into neuronal precursor cells. J Biol Chem. 2009;284:23806-17 pubmed publisher
	Ropolo M, Daga A, Griffero F, Foresta M, Casartelli G, Zunino A, et al. Comparative analysis of DNA repair in stem and nonstem glioma cell cultures. Mol Cancer Res. 2009;7:383-92 pubmed publisher
	Castriconi R, Daga A, Dondero A, Zona G, Poliani P, Melotti A, et al. NK cells recognize and kill human glioblastoma cells with stem cell-like properties. J Immunol. 2009;182:3530-9 pubmed publisher
	Gangemi R, Griffero F, Marubbi D, Perera M, Capra M, Malatesta P, et al. SOX2 silencing in glioblastoma tumor-initiating cells causes stop of proliferation and loss of tumorigenicity. Stem Cells. 2009;27:40-8 pubmed publisher
	Wright L, Li J, Caldwell M, Wallace K, Johnson J, Svendsen C. Gene expression in human neural stem cells: effects of leukemia inhibitory factor. J Neurochem. 2003;86:179-95 pubmed
	Messam C, Hou J, Berman J, Major E. Analysis of the temporal expression of nestin in human fetal brain derived neuronal and glial progenitor cells. Brain Res Dev Brain Res. 2002;134:87-92 pubmed

product information

master code :

NBP1-88845

SKU :

NBP1-88845

product name :

ZEB1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The ZEB1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ZEB1. This antibody reacts with human,mouse. The ZEB1 Antibody - BSA Free has been validated for the following applications: Chromatin Immunoprecipitation-exo-Seq,Chromatin Immunoprecipitation Sequencing,Chemotaxis,Chip Cytometry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

ZEB1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

concentration :

0.2 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALN
AQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS
EPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPL
KMTNSPVLPVGST
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

theoretical molecular weight :

124 kDa

gene symbol :

ZEB1

Antibody validation :

Orthogonal Validation

accessionNumbers :

P37275

applications :

Chromatin Immunoprecipitation Sequencing,Chemotaxis,Chip Cytometry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

559 USD

alt names :

AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage