product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ZEB1 Antibody - BSA Free
catalog :
NBP1-88845
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
10C2
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 29
Published Application/Species/Sample/DilutionReference
  • western blot; human; 1:1000; loading ...; fig 1a
Bi J, Yang S, Li L, Dai Q, Borcherding N, Wagner B, et al. Metadherin enhances vulnerability of cancer cells to ferroptosis. Cell Death Dis. 2019;10:682 pubmed publisher
  • western blot; human; 1:1000; loading ...; fig s4a
Vanneste M, Huang Q, Li M, Moose D, Zhao L, STAMNES M, et al. High content screening identifies monensin as an EMT-selective cytotoxic compound. Sci Rep. 2019;9:1200 pubmed publisher
Han Y, Villarreal Ponce A, Gutiérrez G, Nguyen Q, Sun P, Wu T, et al. Coordinate control of basal epithelial cell fate and stem cell maintenance by core EMT transcription factor Zeb1. Cell Rep. 2022;38:110240 pubmed publisher
Feldker N, Ferrazzi F, Schuhwerk H, Widholz S, Guenther K, Frisch I, et al. Genome-wide cooperation of EMT transcription factor ZEB1 with YAP and AP-1 in breast cancer. EMBO J. 2020;:e103209 pubmed publisher
Sabelström H, Petri R, Shchors K, Jandial R, Schmidt C, Sacheva R, et al. Driving Neuronal Differentiation through Reversal of an ERK1/2-miR-124-SOX9 Axis Abrogates Glioblastoma Aggressiveness. Cell Rep. 2019;28:2064-2079.e11 pubmed publisher
Adamska A, Pilacinski S, Zozulinska Ziolkiewicz D, Gandecka A, Grzelka A, Konwerska A, et al. An increased skin microvessel density is associated with neurovascular complications in type 1 diabetes mellitus. Diab Vasc Dis Res. 2019;16:513-522 pubmed publisher
Balzamino B, Esposito G, Marino R, Keller F, Micera A. Changes in vitreal protein profile and retina mRNAs in Reeler mice: NGF, IL33 and Müller cell activation. PLoS ONE. 2019;14:e0212732 pubmed publisher
Maxia C, Murtas D, Isola M, Tamma R, Zucca I, Piras F, et al. Immunophenotypic characterization of telocyte-like cells in pterygium. Mol Vis. 2018;24:853-866 pubmed
Adamska A, Araszkiewicz A, Pilacinski S, Gandecka A, Grzelka A, Kowalska K, et al. Dermal microvessel density and maturity is closely associated with atherogenic dyslipidemia and accumulation of advanced glycation end products in adult patients with type 1 diabetes. Microvasc Res. 2019;121:46-51 pubmed publisher
Murtas D, Pilloni L, Diana A, Casula L, Tomei S, Piras F, et al. Tyrosinase and nestin immunohistochemical expression in melanocytic nevi as a histopathologic pattern to trace melanocyte differentiation and nevogenesis. Histochem Cell Biol. 2019;151:175-185 pubmed publisher
Iwata R, Maruyama M, Ito T, Nakano Y, Kanemura Y, Koike T, et al. Establishment of a tumor sphere cell line from a metastatic brain neuroendocrine tumor. Med Mol Morphol. 2017;50:211-219 pubmed publisher
Yao X, Sun S, Zhou X, Zhang Q, Guo W, Zhang L. Clinicopathological significance of ZEB-1 and E-cadherin proteins in patients with oral cavity squamous cell carcinoma. Onco Targets Ther. 2017;10:781-790 pubmed publisher
Barbáchano A, Fernández Barral A, Pereira F, Segura M, Ordóñez Morán P, Carrillo de Santa Pau E, et al. SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150. Oncogene. 2016;35:2991-3003 pubmed publisher
Asnaghi L, Gezgin G, Tripathy A, Handa J, Merbs S, van der Velden P, et al. EMT-associated factors promote invasive properties of uveal melanoma cells. Mol Vis. 2015;21:919-29 pubmed
Mock K, Preca B, Brummer T, Brabletz S, Stemmler M, Brabletz T. The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors. Oncotarget. 2015;6:14399-412 pubmed
Meidhof S, Brabletz S, Lehmann W, Preca B, Mock K, Ruh M, et al. ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat. EMBO Mol Med. 2015;7:831-47 pubmed publisher
Isella C, Terrasi A, Bellomo S, Petti C, Galatola G, Muratore A, et al. Stromal contribution to the colorectal cancer transcriptome. Nat Genet. 2015;47:312-9 pubmed publisher
Davidson B, Holth A, Hellesylt E, Tan T, Huang R, Tropé C, et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol. 2015;46:1-8 pubmed publisher
Murtas D, Piras F, Minerba L, Maxia C, Ferreli C, Demurtas P, et al. Activated Notch1 expression is associated with angiogenesis in cutaneous melanoma. Clin Exp Med. 2015;15:351-60 pubmed publisher
Heroux M, Chesnik M, Halligan B, Al Gizawiy M, Connelly J, Mueller W, et al. Comprehensive characterization of glioblastoma tumor tissues for biomarker identification using mass spectrometry-based label-free quantitative proteomics. Physiol Genomics. 2014;46:467-81 pubmed publisher
Lai S, Piras F, Spiga S, Perra M, Minerba L, Piga M, et al. Nestin and vimentin colocalization affects the subcellular location of glucocorticoid receptor in cutaneous melanoma. Histopathology. 2013;62:487-98 pubmed publisher
Kondo S, Wakisaka N, Muramatsu M, Zen Y, Endo K, Murono S, et al. Epstein-Barr virus latent membrane protein 1 induces cancer stem/progenitor-like cells in nasopharyngeal epithelial cell lines. J Virol. 2011;85:11255-64 pubmed publisher
Loudig O, Brandwein Gensler M, Kim R, Lin J, Isayeva T, Liu C, et al. Illumina whole-genome complementary DNA-mediated annealing, selection, extension and ligation platform: assessing its performance in formalin-fixed, paraffin-embedded samples and identifying invasion pattern-related genes in oral squamous cell carcin. Hum Pathol. 2011;42:1911-22 pubmed publisher
Porayette P, Gallego M, Kaltcheva M, Bowen R, Vadakkadath Meethal S, Atwood C. Differential processing of amyloid-beta precursor protein directs human embryonic stem cell proliferation and differentiation into neuronal precursor cells. J Biol Chem. 2009;284:23806-17 pubmed publisher
Ropolo M, Daga A, Griffero F, Foresta M, Casartelli G, Zunino A, et al. Comparative analysis of DNA repair in stem and nonstem glioma cell cultures. Mol Cancer Res. 2009;7:383-92 pubmed publisher
Castriconi R, Daga A, Dondero A, Zona G, Poliani P, Melotti A, et al. NK cells recognize and kill human glioblastoma cells with stem cell-like properties. J Immunol. 2009;182:3530-9 pubmed publisher
Gangemi R, Griffero F, Marubbi D, Perera M, Capra M, Malatesta P, et al. SOX2 silencing in glioblastoma tumor-initiating cells causes stop of proliferation and loss of tumorigenicity. Stem Cells. 2009;27:40-8 pubmed publisher
Wright L, Li J, Caldwell M, Wallace K, Johnson J, Svendsen C. Gene expression in human neural stem cells: effects of leukemia inhibitory factor. J Neurochem. 2003;86:179-95 pubmed
Messam C, Hou J, Berman J, Major E. Analysis of the temporal expression of nestin in human fetal brain derived neuronal and glial progenitor cells. Brain Res Dev Brain Res. 2002;134:87-92 pubmed
product information
brand :
Novus
catalog number base :
NBP1-88845
SKU :
NBP1-88845
product name :
ZEB1 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The ZEB1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ZEB1. This antibody reacts with human,mouse. The ZEB1 Antibody - BSA Free has been validated for the following applications: Chemotaxis,Chip Cytometry,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Chromatin Immunoprecipitation Sequencing,Chromatin Immunoprecipitation-exo-Seq,Immunocytochemistry/ Immunofluorescence.
target :
ZEB1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
concentration :
0.2 mg/ml
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALN
AQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS
EPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPL
KMTNSPVLPVGST
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
theoretical molecular weight :
124 kDa
gene symbol :
ZEB1
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]
accessionNumbers :
P37275
applications :
Chemotaxis,Chip Cytometry,IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Gel Supershift Assay,Chromatin Immunoprecipitation Sequencing,Chromatin Immunoprecipitation-exo-Seq,Immunocytochemistry/ Immunofluorescence
USD :
559 USD
alt names :
AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.