Mkl1 Antibody - BSA Free | Novus Biologicals NBP1-88498 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Mkl1 Antibody - BSA Free

catalog :

NBP1-88498

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; mouse; 1:200; loading ...; fig 1a, 1d, 4e, 3h immunohistochemistry - paraffin section; human; 1:200; loading ...; fig 1b	Yao C, Haensel D, Gaddam S, Patel T, Atwood S, Sarin K, et al. AP-1 and TGFß cooperativity drives non-canonical Hedgehog signaling in resistant basal cell carcinoma. Nat Commun. 2020;11:5079 pubmed publisher
	Paredes F, Williams H, Liu X, Holden C, Bogan B, Wang Y, et al. The mitochondrial protease ClpP is a druggable target that controls VSMC phenotype by a SIRT1-dependent mechanism. Redox Biol. 2024;73:103203 pubmed publisher
	Paredes F, Williams H, Quintana R, San Martin A. Mitochondrial Protein Poldip2 Controls VSMC Differentiated Phenotype by O-Linked GlcNAc Transferase-Dependent Inhibition of a Ubiquitin Proteasome System. Circ Res. 2019;: pubmed publisher
	Whitson R, Lee A, Urman N, Mirza A, Yao C, Brown A, et al. Noncanonical hedgehog pathway activation through SRF-MKL1 promotes drug resistance in basal cell carcinomas. Nat Med. 2018;24:271-281 pubmed publisher
	Record J, Malinova D, Zenner H, Plagnol V, Nowak K, Syed F, et al. Immunodeficiency and severe susceptibility to bacterial infection associated with a loss-of-function homozygous mutation of MKL1. Blood. 2015;126:1527-35 pubmed publisher
	Gjorevski N, Piotrowski A, Varner V, Nelson C. Dynamic tensile forces drive collective cell migration through three-dimensional extracellular matrices. Sci Rep. 2015;5:11458 pubmed publisher

product information

master code :

NBP1-88498

SKU :

NBP1-88498

product name :

Mkl1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The Mkl1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Mkl1. This antibody reacts with human,mouse. The Mkl1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated.

target :

Mkl1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPA
HPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPE
PVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVT
NKNADSPG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

MRTFA

Antibody validation :

Knockout/Knockdown

accessionNumbers :

Q969V6

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated

USD :

559 USD

alt names :

AMKL, KIAA1438, MALSAP and coiled-coil domain, megakaryoblastic leukemia (translocation) 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, MKL/myocardin-like protein 1, Myocardin-related transcription factor A, RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage