RBCK1 Antibody - BSA Free | Novus Biologicals NBP1-88301 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RBCK1 Antibody - BSA Free

catalog :

NBP1-88301

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

6C6

reactivity :

human, mouse

application :

western blot, immunoprecipitation, western blot knockout validation

more info or order :

Novus Biologicals product webpage

citations: 11

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; mouse; loading ...; fig 2a	Shibata Y, Tokunaga F, Goto E, Komatsu G, Gohda J, Saeki Y, et al. HTLV-1 Tax Induces Formation of the Active Macromolecular IKK Complex by Generating Lys63- and Met1-Linked Hybrid Polyubiquitin Chains. PLoS Pathog. 2017;13:e1006162 pubmed publisher
western blot; human; 1:1000; fig s15	Nakazawa S, Oikawa D, Ishii R, Ayaki T, Takahashi H, Takeda H, et al. Linear ubiquitination is involved in the pathogenesis of optineurin-associated amyotrophic lateral sclerosis. Nat Commun. 2016;7:12547 pubmed publisher
	Hoshino K, Nakazawa S, Yokobori T, Hagiwara K, Ishii N, Tsukagoshi M, et al. RNF31 promotes proliferation and invasion of hepatocellular carcinoma via nuclear factor kappaB activation. Sci Rep. 2024;14:346 pubmed publisher
	Peng R, Wang C, Wang Kan X, Idorn M, Kjaer M, Zhou F, et al. Human ZBP1 induces cell death-independent inflammatory signaling via RIPK3 and RIPK1. EMBO Rep. 2022;23:e55839 pubmed publisher
	Douglas T, Saleh M. Cross-regulation between LUBAC and caspase-1 modulates cell death and inflammation. J Biol Chem. 2020;295:5216-5228 pubmed publisher
	Yamanaka S, Sato Y, Oikawa D, Goto E, Fukai S, Tokunaga F, et al. Subquinocin, a small molecule inhibitor of CYLD and USP-family deubiquitinating enzymes, promotes NF-κB signaling. Biochem Biophys Res Commun. 2019;: pubmed publisher
	Damgaard R, Elliott P, Swatek K, Maher E, Stepensky P, Elpeleg O, et al. OTULIN deficiency in ORAS causes cell type-specific LUBAC degradation, dysregulated TNF signalling and cell death. EMBO Mol Med. 2019;11: pubmed publisher
	MacDuff D, Baldridge M, Qaqish A, Nice T, Darbandi A, Hartley V, et al. HOIL1 Is Essential for the Induction of Type I and III Interferons by MDA5 and Regulates Persistent Murine Norovirus Infection. J Virol. 2018;92: pubmed publisher
	Polajnar M, Dietz M, Heilemann M, Behrends C. Expanding the host cell ubiquitylation machinery targeting cytosolic Salmonella. EMBO Rep. 2017;18:1572-1585 pubmed publisher
	Klein T, Fung S, Renner F, Blank M, Dufour A, Kang S, et al. The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-ÎºB signalling. Nat Commun. 2015;6:8777 pubmed publisher
	Lewis M, Vyse S, Shields A, Boeltz S, Gordon P, Spector T, et al. UBE2L3 polymorphism amplifies NF-ÎºB activation and promotes plasma cell development, linking linear ubiquitination to multiple autoimmune diseases. Am J Hum Genet. 2015;96:221-34 pubmed publisher

product information

master code :

NBP1-88301

SKU :

NBP1-88301

product name :

RBCK1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The RBCK1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to RBCK1. This antibody reacts with human,mouse. The RBCK1 Antibody - BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,Immunoblotting.

target :

RBCK1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVL
QQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTS
LNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPG
VPQEPGRGQPDAVPEP
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

RBCK1

Antibody validation :

Orthogonal Validation

applications :

Immunoprecipitation,Western Blot,Immunoblotting

USD :

559 USD

alt names :

C20orf18, EC 6.3.2.-, HBV associated factor 4, HBV-associated factor 4, Heme-oxidized IRP2 ubiquitin ligase 1, Hepatitis B virus X-associated protein 4, HOIL-1, RanBP-type and C3HC4-type zinc finger containing 1, ranBP-type and C3HC4-type zinc finger-containing protein 1, RBCC protein interacting with PKC1, RBCK2, RNF54RING finger protein 54, UBCE7IP3HOIL1, ubiquitin conjugating enzyme 7 interacting protein 3, Ubiquitin-conjugating enzyme 7-interacting protein 3, XAP3, XAP4chromosome 20 open reading frame 18, ZRANB4

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage